CAZyme Information: MGYG000001595_01297

Basic Information

• Species: Fusobacterium_B sp900545035
• Lineage: Bacteria; Fusobacteriota; Fusobacteriia; Fusobacteriales; Fusobacteriaceae; Fusobacterium_B; Fusobacterium_B sp900545035
• CAZyme ID: MGYG000001595_01297
• CAZy Family: GT9
• CAZyme Description: Lipopolysaccharide core heptosyltransferase RfaQ

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
336	MGYG000001595_93|CGC1	39533.09	9.3914

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001595	1844851	MAG	China	Asia

• Gene Location: Start: 535; End: 1545 Strand: -

Full Sequence      

MKKFLIIRYKKSVGDTIIGTTLCEDLKKKYPDSEVHYLVYENLTELFLNHKYIDKVLTLN
RKEGAKGYLKLLRQIRKEKYYAVIDCRSIPLTLYLTIFSGAEIKIGKYKKYRHIFYDYAI
KGMENKMNQIKKYHMMLKPLGVETVTTEYKTYLTDEEKSLWKKKMEESGIDFSRLVIPIA
VNARQTFKKYPEEYMEKIIRTLAEKYGCQIILTYSPAEEEDTKQMYNKLSDIKKNIFINL
KTKNVRELACVFSNCDLFVGNEGGTRHVAEMAGLANIAIISPETDKKEWLSNENEKNQCI
DVNDVNGKEYLDIKPEYVMERIEKQLKTFNYFGKKI

Enzyme Prediction     

No EC number prediction in MGYG000001595_01297.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT9	69	303	6e-33	0.9022222222222223

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd03789	GT9_LPS_heptosyltransferase	1.37e-40	3	324	1	277	lipopolysaccharide heptosyltransferase and similar proteins. Lipopolysaccharide heptosyltransferase (2.4.99.B6) is involved in the biosynthesis of lipooligosaccharide (LOS). Lipopolysaccharide (LPS) is a major component of the outer membrane of gram-negative bacteria. LPS heptosyltransferase transfers heptose molecules from ADP-heptose to 3-deoxy-D-manno-octulosonic acid (KDO), a part of the inner core component of LPS. This family also contains lipopolysaccharide 1,2-N-acetylglucosaminetransferase EC 2.4.1.56 and belongs to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.
COG0859	RfaF	1.50e-37	1	328	1	332	ADP-heptose:LPS heptosyltransferase [Cell wall/membrane/envelope biogenesis].
pfam01075	Glyco_transf_9	3.82e-13	69	308	2	245	Glycosyltransferase family 9 (heptosyltransferase). Members of this family belong to glycosyltransferase family 9. Lipopolysaccharide is a major component of the outer leaflet of the outer membrane in Gram-negative bacteria. It is composed of three domains; lipid A, Core oligosaccharide and the O-antigen. All of these enzymes transfer heptose to the lipopolysaccharide core.
PRK10422	PRK10422	9.93e-10	2	289	6	296	lipopolysaccharide core biosynthesis protein; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AVQ18853.1	1.23e-168	1	336	1	335
ADO84502.1	5.63e-86	3	329	2	333
BBA49699.1	3.33e-78	3	324	2	335
SQJ14939.1	1.07e-77	3	329	2	339
AVQ27547.1	1.07e-77	3	329	2	339

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3TOV_A	9.65e-08	3	282	9	289	Thecrystal structure of the glycosyl transferase family 9 from Veillonella parvula DSM 2008 [Veillonella parvula DSM 2008],3TOV_B The crystal structure of the glycosyl transferase family 9 from Veillonella parvula DSM 2008 [Veillonella parvula DSM 2008]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9R9D5	8.02e-11	14	289	5	284	Lipopolysaccharide core heptosyltransferase RfaQ OS=Escherichia coli OX=562 GN=rfaQ PE=1 SV=1
P44011	9.22e-08	1	289	1	296	Putative glycosyltransferase HI_0523 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=HI_0523 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000071	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001595_01297.