CAZyme Information: MGYG000001596_00191

Basic Information

• Species: Blautia sp900543715
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Blautia; Blautia sp900543715
• CAZyme ID: MGYG000001596_00191
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
305	MGYG000001596_2|CGC1	35174.83	9.8772

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001596	3243391	MAG	China	Asia

• Gene Location: Start: 79869; End: 80786 Strand: +

Full Sequence      

MSVTVIVPTYKPGDKFSRLIEGLKKQTIFPDKIIIMNTEEKFWKDSMISGAKGVQVFHIS
KEEFDHGRTRAQAAEMADSEFLIFFTQDAVPADRYTVENLLKPFRDPQVAAVYGRQLPDQ
DCRMIERYTRSFNYPENSLKKTKNDISRLGIKTFFCSNVCAAYRKSVYEELGGFTFPVIF
NEDMIMAGNMVKAGYGIFYAADACVIHSHNYSWIQQFKRNFDLAVSQADHPEIFKGMPSE
GEGIRLVKSTGKYLLKKRKPWLLPQLVMSSGFKFLGYRMGKIYRKLPMALVLRFTMSPGY
WKNRE

Enzyme Prediction     

No EC number prediction in MGYG000001596_00191.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	4	172	2.1e-17	0.9941176470588236

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam13641	Glyco_tranf_2_3	7.96e-15	3	221	4	225	Glycosyltransferase like family 2. Members of this family of prokaryotic proteins include putative glucosyltransferase, which are involved in bacterial capsule biosynthesis.
COG1215	BcsA	8.41e-13	3	205	56	262	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
COG1216	GT2	6.19e-11	1	212	3	224	Glycosyltransferase, GT2 family [Carbohydrate transport and metabolism].
cd06434	GT2_HAS	7.83e-11	2	205	1	210	Hyaluronan synthases catalyze polymerization of hyaluronan. Hyaluronan synthases (HASs) are bi-functional glycosyltransferases that catalyze polymerization of hyaluronan. HASs transfer both GlcUA and GlcNAc in beta-(1,3) and beta-(1,4) linkages, respectively to the hyaluronan chain using UDP-GlcNAc and UDP-GlcUA as substrates. HA is made as a free glycan, not attached to a protein or lipid. HASs do not need a primer for HA synthesis; they initiate HA biosynthesis de novo with only UDP-GlcNAc, UDP-GlcUA, and Mg2+. Hyaluronan (HA) is a linear heteropolysaccharide composed of (1-3)-linked beta-D-GlcUA-beta-D-GlcNAc disaccharide repeats. It can be found in vertebrates and a few microbes and is typically on the cell surface or in the extracellular space, but is also found inside mammalian cells. Hyaluronan has several physiochemical and biological functions such as space filling, lubrication, and providing a hydrated matrix through which cells can migrate.
cd06423	CESA_like	2.33e-10	5	185	1	177	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AWY99516.1	1.34e-140	1	303	1	303
QJU13078.1	7.28e-139	2	305	5	308
QBE96877.1	5.95e-138	2	305	5	308
QMW79879.1	5.95e-138	2	305	5	308
QIB57343.1	5.95e-138	2	305	5	308

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P26403	4.46e-83	1	303	1	304	O antigen biosynthesis rhamnosyltransferase RfbN OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=rfbN PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000037	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001596_00191.