CAZyme Information: MGYG000001597_00239

Basic Information

• Species: UBA866 sp900543295
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Ruminococcaceae; UBA866; UBA866 sp900543295
• CAZyme ID: MGYG000001597_00239
• CAZy Family: CBM67
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
751	MGYG000001597_6|CGC2	85339.82	6.3722

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001597	2473217	MAG	China	Asia

• Gene Location: Start: 19715; End: 21970 Strand: -

Full Sequence      

MFPQRFISASHSYTTLERPVAAPMLRRCFSASKPVRRAEALICGLGFYELYVNGEQVTKG
FLAPYISNPDHILYYDRYDLTSFLHPGKNALGVILGNGFLNNPGGAVWDFHLAPWRAAPM
LSMRVTMEYEDGETVSFEADERFRTAPSPILFDDLRAGEDYDARLYEKNWAQPDFHDGSW
EHAFFVTPPRGEKRMTAAQPIRVERRVLPVAVEPEGDGWRYDFGENNAGFFELCICGKSG
QKIELSFGETVESGRMLTENHIFREELRVQKVRYILSGKGEEHYIPHFSYFGYRYIRVVG
ITAEQAKPSLLTMLPAHSDIGSRGAFACSDERLNQLQEYARRSTLSNFYYFPTDCPHREK
NGWTGDASLSAEQTLLNFEPEKSYAEWLRNIRKAQAENGRLPGIVPTGTWGYTWGNGPAW
DSALFTLPYYTYLYRGGKTILRENASAFMRYLVYIRSKRMENGLVSCGLGDWLQPYREAH
EYSTPLEFTDSVYTMDIARKAAFLFREIDMKAEACYADCLFREMREAVRRELISFPECRV
CGGGQTPQAMAIFYDVLDREEKKAAFTLLLDAIQKEGGRIYTGMLGGRALFHVLAEYGEA
DLALQMITRPDYPSFGNWLSKGATTLWEEFTPEGGRTLSLNHHCWAFISGFFLKDIAGIR
INPNKRGADTVLLAPSFPASLSYAEGRHESVCGEVLIRWEKTPEGVALDIRVPDGMYAEL
KLPAGYQLTDRCAPNHTIIETGRYLAVQRRP

Enzyme Prediction     

No EC number prediction in MGYG000001597_00239.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	216	722	6.7e-119	0.9880952380952381
CBM67	18	189	1.1e-29	0.9034090909090909

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	6.69e-71	324	652	4	336	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam08531	Bac_rhamnosid_N	6.77e-45	33	203	1	170	Alpha-L-rhamnosidase N-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. This domain is probably involved in substrate recognition.
pfam05592	Bac_rhamnosid	3.00e-16	221	326	10	102	Bacterial alpha-L-rhamnosidase concanavalin-like domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam17390	Bac_rhamnosid_C	4.86e-10	661	725	2	66	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGQ94103.1	4.35e-152	14	727	135	845
QNN24933.1	2.75e-147	22	723	352	1055
AHF16194.1	8.24e-142	15	723	165	862
AYB33152.1	9.27e-142	23	725	185	879
AYD48149.1	3.23e-141	22	723	156	859

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6I60_A	2.44e-110	22	723	176	899	Structureof alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12],6I60_B Structure of alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12]
3W5M_A	1.70e-75	21	736	301	1006	CrystalStructure of Streptomyces avermitilis alpha-L-rhamnosidase [Streptomyces avermitilis MA-4680 = NBRC 14893],3W5N_A Crystal Structure of Streptomyces avermitilis alpha-L-rhamnosidase complexed with L-rhamnose [Streptomyces avermitilis MA-4680 = NBRC 14893]
6GSZ_A	3.08e-60	18	693	130	826	Crystalstructure of native alfa-L-rhamnosidase from Aspergillus terreus [Aspergillus terreus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KPL4	2.50e-90	16	722	173	906	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22170 PE=2 SV=1
T2KNB2	6.29e-75	25	723	177	879	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22090 PE=1 SV=2
Q82PP4	8.18e-75	21	736	301	1006	Alpha-L-rhamnosidase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) OX=227882 GN=SAVERM_828 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000051	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001597_00239.