CAZyme Information: MGYG000001597_01034

Basic Information

• Species: UBA866 sp900543295
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Ruminococcaceae; UBA866; UBA866 sp900543295
• CAZyme ID: MGYG000001597_01034
• CAZy Family: GH36
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
528	MGYG000001597_45|CGC1	58778.72	4.8282

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001597	2473217	MAG	China	Asia

• Gene Location: Start: 8322; End: 9908 Strand: +

Full Sequence      

MDFFPDISRLPDFITIETERETASFSGGSDIPFHDVCVRITVADSVNVSLSADTTPVLRL
RLRWNAPVPAGTRFCGDAWERGYGDFEWRGFVAERIMPWYFYASCKDAFAGYGVRVRPDA
MCFFCCDPAGVTLTVDVRCGGAGVVLKGKTIACAEAVCAEYKGISSFEAACRFTSLLCCD
GIFPDVPVYGANNWYYAYGKSSQTEILADASYLAELTDGLKNRPFMVIDDGWQKLRSDSY
IGGPWRAGNDRFPDMEALSAGISAHDVIPGIWFRPLQNRDESLPEKCRLSFDADCLDPSV
PEALDYIAQDVRTLTGWGYRLIKHDFSTFDLLRYWGVFMQSSISSQPGVPFADRSKTTAM
IIKDLYRTIYESAGGKAMILGCNCIGHLGAGYMEINRTGDDTSGIEWERTRQRGVNTLAF
RMPQHNRFYAVDADCCGITGAIDWRKNEQWLSLLANSGTPLFVSVKPGTLMPEQEELLRA
AYARAAVSQPAAVPIDWMDTTCPVNWQIGKKTVSFDWFDRTGIPNLQI

Enzyme Prediction     

No EC number prediction in MGYG000001597_01034.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd14791	GH36	8.46e-39	187	476	2	288	glycosyl hydrolase family 36 (GH36). GH36 enzymes occur in prokaryotes, eukaryotes, and archaea with a wide range of hydrolytic activities, including alpha-galactosidase, alpha-N-acetylgalactosaminidase, stachyose synthase, and raffinose synthase. All GH36 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein. GH36 members are retaining enzymes that cleave their substrates via an acid/base-catalyzed, double-displacement mechanism involving a covalent glycosyl-enzyme intermediate. Two aspartic acid residues have been identified as the catalytic nucleophile and the acid/base, respectively.
COG3345	GalA	1.52e-08	190	340	295	459	Alpha-galactosidase [Carbohydrate transport and metabolism].
cd14792	GH27	1.09e-06	193	326	6	124	glycosyl hydrolase family 27 (GH27). GH27 enzymes occur in eukaryotes, prokaryotes, and archaea with a wide range of hydrolytic activities, including alpha-glucosidase (glucoamylase and sucrase-isomaltase), alpha-N-acetylgalactosaminidase, and 3-alpha-isomalto-dextranase. All GH27 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein. GH27 members are retaining enzymes that cleave their substrates via an acid/base-catalyzed, double-displacement mechanism involving a covalent glycosyl-enzyme intermediate. Two aspartic acid residues have been identified as the catalytic nucleophile and the acid/base, respectively.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QCU01578.1	4.78e-188	10	522	30	544
CBL19648.1	4.78e-188	10	522	30	544
BDA09953.1	1.41e-181	11	523	11	531
QIB59833.1	5.66e-181	11	523	11	531
AFU70663.1	7.70e-178	11	523	11	529

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000036	0.000004	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001597_01034.