CAZyme Information: MGYG000001597_02307

Basic Information

• Species: UBA866 sp900543295
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Ruminococcaceae; UBA866; UBA866 sp900543295
• CAZyme ID: MGYG000001597_02307
• CAZy Family: GH31
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
194		22057.84	7.8177

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001597	2473217	MAG	China	Asia

• Gene Location: Start: 1517; End: 2101 Strand: -

Full Sequence      

MQRLGDKDYSWKAVGLLVPDMIAAGLLGYAYACPDMIGGGQFGSFLGVDQTKLDQELIVR
SCQVHALMPMMQFSVAPWRILDEKHLAICRDYAHLHEKMGTYILELAHHAAKTGEPIIRH
MEYVFPHQGFIDCKDQFMLGDKYLVAPVLTKEHTRTVRLPKGVWLDDTGKKFKGPKTIEV
TASLERLPWFEKIK

Enzyme Prediction     

No EC number prediction in MGYG000001597_02307.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH31	3	191	5.9e-44	0.4379391100702576

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06592	GH31_NET37	2.37e-73	1	164	202	364	glucosidase NET37. NET37 (also known as KIAA1161) is a human lamina-associated nuclear envelope transmembrane protein. A member of the glycosyl hydrolase family 31 (GH31) , it has been shown to be required for myogenic differentiation of C2C12 cells. Related proteins are found in eukaryotes and prokaryotes. Enzymes of the GH31 family possess a wide range of different hydrolytic activities including alpha-glucosidase (glucoamylase and sucrase-isomaltase), alpha-xylosidase, 6-alpha-glucosyltransferase, 3-alpha-isomaltosyltransferase and alpha-1,4-glucan lyase. All GH31 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein.
pfam01055	Glyco_hydro_31	1.85e-30	1	188	242	433	Glycosyl hydrolases family 31. Glycosyl hydrolases are key enzymes of carbohydrate metabolism. Family 31 comprises of enzymes that are, or similar to, alpha- galactosidases.
COG1501	YicI	2.02e-30	5	192	478	665	Alpha-glucosidase, glycosyl hydrolase family GH31 [Carbohydrate transport and metabolism].
cd06596	GH31_CPE1046	1.15e-22	5	166	166	330	Clostridium CPE1046-like. CPE1046 is an uncharacterized Clostridium perfringens protein with a glycosyl hydrolase family 31 (GH31) domain. The domain architecture of CPE1046 and its orthologs includes a C-terminal fibronectin type 3 (FN3) domain and a coagulation factor 5/8 type C domain in addition to the GH31 domain. Enzymes of the GH31 family possess a wide range of different hydrolytic activities including alpha-glucosidase (glucoamylase and sucrase-isomaltase), alpha-xylosidase, 6-alpha-glucosyltransferase, 3-alpha-isomaltosyltransferase and alpha-1,4-glucan lyase. All GH31 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein.
cd06603	GH31_GANC_GANAB_alpha	2.79e-22	5	190	234	419	neutral alpha-glucosidase C, neutral alpha-glucosidase AB. This subgroup includes the closely related glycosyl hydrolase family 31 (GH31) isozymes, neutral alpha-glucosidase C (GANC) and the alpha subunit of heterodimeric neutral alpha-glucosidase AB (GANAB). Initially distinguished on the basis of differences in electrophoretic mobility in starch gel, GANC and GANAB have been shown to have other differences, including those of substrate specificity. GANC and GANAB are key enzymes in glycogen metabolism that hydrolyze terminal, non-reducing 1,4-linked alpha-D-glucose residues from glycogen in the endoplasmic reticulum. The GANC/GANAB family includes the alpha-glucosidase II (ModA) from Dictyostelium discoideum as well as the alpha-glucosidase II (GLS2, or ROT2 - Reversal of TOR2 lethality protein 2) from Saccharomyces cerevisiae.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT50281.1	5.56e-130	1	194	338	531
QRP90828.1	1.63e-101	1	193	359	549
AKA54123.1	2.51e-101	1	193	337	527
ANQ59908.1	2.51e-101	1	193	337	527
QCT77881.1	4.60e-101	1	193	359	549

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2G3M_A	5.45e-11	5	184	415	598	Crystalstructure of the Sulfolobus solfataricus alpha-glucosidase MalA [Saccharolobus solfataricus],2G3M_B Crystal structure of the Sulfolobus solfataricus alpha-glucosidase MalA [Saccharolobus solfataricus],2G3M_C Crystal structure of the Sulfolobus solfataricus alpha-glucosidase MalA [Saccharolobus solfataricus],2G3M_D Crystal structure of the Sulfolobus solfataricus alpha-glucosidase MalA [Saccharolobus solfataricus],2G3M_E Crystal structure of the Sulfolobus solfataricus alpha-glucosidase MalA [Saccharolobus solfataricus],2G3M_F Crystal structure of the Sulfolobus solfataricus alpha-glucosidase MalA [Saccharolobus solfataricus],2G3N_A Crystal structure of the Sulfolobus solfataricus alpha-glucosidase MalA in complex with beta-octyl-glucopyranoside [Saccharolobus solfataricus],2G3N_B Crystal structure of the Sulfolobus solfataricus alpha-glucosidase MalA in complex with beta-octyl-glucopyranoside [Saccharolobus solfataricus],2G3N_C Crystal structure of the Sulfolobus solfataricus alpha-glucosidase MalA in complex with beta-octyl-glucopyranoside [Saccharolobus solfataricus],2G3N_D Crystal structure of the Sulfolobus solfataricus alpha-glucosidase MalA in complex with beta-octyl-glucopyranoside [Saccharolobus solfataricus],2G3N_E Crystal structure of the Sulfolobus solfataricus alpha-glucosidase MalA in complex with beta-octyl-glucopyranoside [Saccharolobus solfataricus],2G3N_F Crystal structure of the Sulfolobus solfataricus alpha-glucosidase MalA in complex with beta-octyl-glucopyranoside [Saccharolobus solfataricus]
7KMP_A	7.37e-09	92	190	756	858	ChainA, Alpha-xylosidase [Xanthomonas citri pv. citri str. 306],7KNC_A Chain A, Alpha-xylosidase [Xanthomonas citri pv. citri str. 306]
5F7C_A	4.32e-08	5	188	521	706	Crystalstructure of Family 31 alpha-glucosidase (BT_0339) from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5F7C_B Crystal structure of Family 31 alpha-glucosidase (BT_0339) from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5F7C_C Crystal structure of Family 31 alpha-glucosidase (BT_0339) from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5F7C_D Crystal structure of Family 31 alpha-glucosidase (BT_0339) from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]
4XPO_A	4.74e-07	132	188	567	624	Crystalstructure of a novel alpha-galactosidase from Pedobacter saltans [Pseudopedobacter saltans],4XPP_A Crystal structure of Pedobacter saltans GH31 alpha-galactosidase complexed with D-galactose [Pseudopedobacter saltans],4XPQ_A Crystal structure of Pedobacter saltans GH31 alpha-galactosidase complexed with L-fucose [Pseudopedobacter saltans]
4XPR_A	4.74e-07	132	188	567	624	Crystalstructure of the mutant D365A of Pedobacter saltans GH31 alpha-galactosidase [Pseudopedobacter saltans],4XPS_A Crystal structure of the mutant D365A of Pedobacter saltans GH31 alpha-galactosidase complexed with p-nitrophenyl-alpha-galactopyranoside [Pseudopedobacter saltans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q6NSJ0	4.42e-22	3	190	517	710	Myogenesis-regulating glycosidase OS=Homo sapiens OX=9606 GN=MYORG PE=1 SV=2
Q69ZQ1	2.06e-21	3	172	516	692	Myogenesis-regulating glycosidase OS=Mus musculus OX=10090 GN=Myorg PE=1 SV=2
P19965	9.53e-17	3	180	488	658	SITS-binding protein OS=Tetronarce californica OX=7787 PE=1 SV=2
Q9F234	9.65e-15	5	192	483	669	Alpha-glucosidase 2 OS=Bacillus thermoamyloliquefaciens OX=1425 PE=3 SV=1
D0KQM8	2.99e-10	5	184	415	598	Alpha-glucosidase OS=Saccharolobus solfataricus (strain 98/2) OX=555311 GN=malA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.498420	0.479092	0.009143	0.003624	0.002973	0.006745

TMHMM  Annotations     

start	end
13	32