CAZyme Information: MGYG000001599_02209

Basic Information

• Species: Phocaeicola sp900544075
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Phocaeicola; Phocaeicola sp900544075
• CAZyme ID: MGYG000001599_02209
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
786	MGYG000001599_21|CGC1	89207.14	6.0678

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001599	4213385	MAG	China	Asia

• Gene Location: Start: 28041; End: 30401 Strand: -

Full Sequence      

MDKDITFFAVSDNGAVNSSVKGISEGCGPVKHIYNVGINEINTSEGIRRICSLTDTDFVL
LYTKPYPLNLGYKAIERMADYLTPECAGMAYADHYIMKEGVCAPHPVIDYQEGSVRDDFD
FGSLIMFRTDVLRRAAESLKTQKEYYYSGLYALRLAVSRIARIVHIREFLYTEVENDLRK
SGEKQFDYVDPRNRNVQIEREEAFTFHLRKIGAYLPQRTRLIDTEKGDFSCEASVIIPVR
NRVKTIDDAIKSVLEQETDFKFNVIIIDNHSTDGTTECIDRYKDNEKVVHIVPERTDLGI
GGCWNMGIDHPACGRYAVQLDSDDLYSSPKTLQAIVDKFRTEKCAMVIGSYRMTNFSLET
LPPGVIDHKEWTDGNGHNNALRINGLGAPRAFYTPLLREIRVPNTSYGEDYALGLAFSRN
YKIGRIYNVVYLCRRWEGNSDAALSIEKINLNNAYKDSLRTLEINMRRGLAEREADEFTA
TQFEKWELCRKNHEALKGIKTKCVNIGGNTIKVQFNPARAVSTLAKLDKSSINARPCFLC
TKNKPEEQDSISIDAGMRFSIRINPYPILPGHLTISSEEHIPQTLADKAEMQLPMRILQK
VEDYFGQGYAIFYNGAKCGASAPDHFHFQAARKIDIPFIAQWNEIFKSAIEDDTAGIQSG
DVCKAYSVNGFACPIKVFTSFSGNIDTALLFNYLDSLPVHEGEPEPRYNMFAWRDDEGRF
ICAYFPREAHRPSCYFSEGEEQILVSPGALDMAGLIVTPREEDFRKINEADITRIYKEVS
SWKNHI

Enzyme Prediction     

No EC number prediction in MGYG000001599_02209.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	234	356	3e-22	0.7058823529411765

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam16269	DUF4922	5.63e-70	608	780	14	181	Domain of unknown function (DUF4922). This family consists of uncharacterized proteins around 310 residues in length and is mainly found in various Bacteroides and Parabacteroides species. Several members are annotated as putative glycosyltransferases, but the specific function of this family is still unknown.
cd00761	Glyco_tranf_GTA_type	1.59e-22	235	353	1	117	Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold. Glycosyltransferases (GTs) are enzymes that synthesize oligosaccharides, polysaccharides, and glycoconjugates by transferring the sugar moiety from an activated nucleotide-sugar donor to an acceptor molecule, which may be a growing oligosaccharide, a lipid, or a protein. Based on the stereochemistry of the donor and acceptor molecules, GTs are classified as either retaining or inverting enzymes. To date, all GT structures adopt one of two possible folds, termed GT-A fold and GT-B fold. This hierarchy includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. The majority of the proteins in this superfamily are Glycosyltransferase family 2 (GT-2) proteins. But it also includes families GT-43, GT-6, GT-8, GT13 and GT-7; which are evolutionarily related to GT-2 and share structure similarities.
pfam00535	Glycos_transf_2	2.39e-20	234	355	1	119	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.
cd06433	GT_2_WfgS_like	2.52e-19	234	349	1	111	WfgS and WfeV are involved in O-antigen biosynthesis. Escherichia coli WfgS and Shigella dysenteriae WfeV are glycosyltransferase 2 family enzymes involved in O-antigen biosynthesis. GT-2 enzymes have GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
COG0463	WcaA	2.24e-16	234	340	6	108	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADY35406.1	0.0	1	780	1	779
QRO26250.1	0.0	44	781	61	795
QUT58622.1	2.45e-278	38	779	55	802
ABR40252.1	2.45e-278	38	779	55	802
QQY37604.1	2.45e-278	38	779	55	802

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q92IF9	4.19e-08	234	503	296	570	Uncharacterized glycosyltransferase RC0461 OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) OX=272944 GN=RC0461 PE=3 SV=1
O32268	1.04e-07	234	353	9	125	Putative teichuronic acid biosynthesis glycosyltransferase TuaG OS=Bacillus subtilis (strain 168) OX=224308 GN=tuaG PE=2 SV=1
Q4UM29	2.87e-07	232	426	294	482	Uncharacterized glycosyltransferase RF_0543 OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) OX=315456 GN=RF_0543 PE=3 SV=1
Q57287	5.92e-07	234	427	8	192	Uncharacterized glycosyltransferase HI_1578 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=HI_1578 PE=3 SV=1
Q1RIM7	2.11e-06	232	466	292	529	Uncharacterized glycosyltransferase RBE_0706 OS=Rickettsia bellii (strain RML369-C) OX=336407 GN=RBE_0706 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000043	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001599_02209.