CAZyme Information: MGYG000001599_02737

Basic Information

• Species: Phocaeicola sp900544075
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Phocaeicola; Phocaeicola sp900544075
• CAZyme ID: MGYG000001599_02737
• CAZy Family: GH3
• CAZyme Description: Beta-hexosaminidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
858		96719.6	7.0369

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001599	4213385	MAG	China	Asia

• Gene Location: Start: 23219; End: 25795 Strand: +

Full Sequence      

MRIINLGIVIFISLTAYSKPVEKVIYKDSSYPVEKRVDDLLNRMTLDEKIAQISHLHSWN
VFDVQLLNEEKLRKHCGDLSFGFYEGFPLSAEACKKEFHKIQKYFVENTRLGIPAFSVAE
SLHGVVHEGATIFPQNIALGSTFNPGLAYEKARMISGELNTIGIKQVLAPCVDVVRDLRW
GRVEESYSEDPLLCSLMGCSEVKGYLENGISPMLKHYGPHGNPLGGLNLASVECGIRDLY
DVYLKPFEYIIKNTDVMAVMSSYNAWNREPNSSSYYLLTEILRNKFGFRGYVYSDWGVVD
MLKSFHKTAENDFDAACQVLNAGLDVEASSSCFVTLKEKIENGLMDEEVINQSVRRVLRA
KFELGLFEDPYMQKASYKLPLRNKSSVELSKQIADESVVLLKNENNILPLDINKIKSIAV
IGPNANQVQFGDYTWSKDNKDGMTPLEGIKQKAGNKIRVNYQKGCSIHSLDESGIPKAVE
AVKNSDVAVVFVGSSSTAFVRYSQEPSTSGEGIDLHDIFLTGCQEKLIKEVYSVGKPVVV
VLVVGKPFAIPWVKDNIPAILVQWYAGERAGESIADVLFGDVNPSGRLSFSFPKSTGHLP
VYYNYLPTDKGYYKEPGCYDKPGRDYVFSDPKCLWPFGYGLSYTNFKYTNAKVNKEFFNV
YDTIKVDVDVENVGKVKGKEVVQLYVRDVVSKVMSPVKELKAFKKELLYPGEKKTIRLSV
PVHSLYSTDNHGKKYIEEGQFDIYIGGNSEETIAILSVYIGKRDKEQAEKNEQLLITTNS
NNGRKEIIFKGTVRDVQATPIGGVKVQVDDEFVYTDKHGRYQMRIKENSYARFTKPNYKE
QILHVNSDIELNLRMIKE

Enzyme Prediction     

No EC number prediction in MGYG000001599_02737.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	107	327	1.1e-61	0.9768518518518519

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK15098	PRK15098	3.83e-125	37	752	38	757	beta-glucosidase BglX.
COG1472	BglX	2.14e-89	44	467	1	397	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
PLN03080	PLN03080	4.09e-68	28	746	44	769	Probable beta-xylosidase; Provisional
pfam00933	Glyco_hydro_3	3.01e-59	45	360	1	316	Glycosyl hydrolase family 3 N terminal domain.
pfam01915	Glyco_hydro_3_C	3.70e-59	398	643	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ASW16389.1	0.0	26	857	27	857
QQT79218.1	0.0	26	857	27	857
QUT25566.1	0.0	26	857	27	857
QRP58898.1	0.0	26	857	27	857
BCA51778.1	0.0	26	857	27	857

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5YOT_A	1.59e-165	22	760	3	756	Isoprimeverose-producingenzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40],5YOT_B Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40],5YQS_A Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40],5YQS_B Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40]
7EAP_A	1.25e-164	22	760	3	756	ChainA, Fn3_like domain-containing protein [Aspergillus oryzae RIB40]
5Z87_A	1.46e-123	26	750	36	775	ChainA, EmGH1 [Aurantiacibacter marinus],5Z87_B Chain B, EmGH1 [Aurantiacibacter marinus]
5XXL_A	2.01e-111	29	752	6	744	Crystalstructure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5XXL_B Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5XXM_A Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with gluconolactone [Bacteroides thetaiotaomicron VPI-5482],5XXM_B Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with gluconolactone [Bacteroides thetaiotaomicron VPI-5482]
5TF0_A	4.40e-111	34	752	10	743	CrystalStructure of Glycosil Hydrolase Family 3 N-Terminal Domain Protein from Bacteroides intestinalis [Bacteroides intestinalis DSM 17393],5TF0_B Crystal Structure of Glycosil Hydrolase Family 3 N-Terminal Domain Protein from Bacteroides intestinalis [Bacteroides intestinalis DSM 17393]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KMH0	3.24e-136	28	750	28	711	Beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22130 PE=1 SV=1
T2KMH9	5.93e-121	3	749	9	744	Putative beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22230 PE=2 SV=1
Q56078	1.70e-101	37	749	38	754	Periplasmic beta-glucosidase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=bglX PE=3 SV=2
P33363	1.75e-100	37	749	38	754	Periplasmic beta-glucosidase OS=Escherichia coli (strain K12) OX=83333 GN=bglX PE=3 SV=2
P14002	1.58e-90	110	765	34	673	Thermostable beta-glucosidase B OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=bglB PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000278	0.999127	0.000164	0.000144	0.000140	0.000129

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001599_02737.