CAZyme Information: MGYG000001601_00743

Basic Information

• Species: Peptostreptococcus russellii_A
• Lineage: Bacteria; Firmicutes_A; Clostridia; Peptostreptococcales; Peptostreptococcaceae; Peptostreptococcus; Peptostreptococcus russellii_A
• CAZyme ID: MGYG000001601_00743
• CAZy Family: GH73
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
237	MGYG000001601_8|CGC1	27792.91	10.3854

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001601	1998441	MAG	China	Asia

• Gene Location: Start: 18458; End: 19171 Strand: +

Full Sequence      

MEIGRVSARKRKKINNNVSSTSGNYKKKQKKRPRKKRKRLRKLPILILLVFAFFIYSIFS
IGNKISQNKIEEQSLYKEEFISKIEKKAEEEYTKNGVLPSITMGQAILESNWGKSRLALE
GNNLFGIKADKNWKGERINFTTKENYKDYIKADFRKYSSWDESISDYASFLRNNKRYEKH
GMFDSKDYVKQAQALEDAGYATAINEKGEKIYAERLIAVIEKYNLRKYDIEAINKGY

Enzyme Prediction     

No EC number prediction in MGYG000001601_00743.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH73	86	225	3.5e-38	0.9765625

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1705	FlgJ	2.88e-55	46	229	5	188	Flagellum-specific peptidoglycan hydrolase FlgJ [Cell wall/membrane/envelope biogenesis, Cell motility].
PRK05684	flgJ	5.05e-34	78	237	153	308	flagellar assembly peptidoglycan hydrolase FlgJ.
PRK12713	flgJ	2.17e-25	79	220	183	323	flagellar rod assembly protein/muramidase FlgJ; Provisional
NF038016	sporang_Gsm	3.40e-25	78	229	161	312	sporangiospore maturation cell wall hydrolase GsmA. The peptidoglycan-hydrolyzing enzyme GsmA occurs in some sporangia-forming members of the Actinobacteria, such as Actinoplanes missouriensis, and is required for proper separation of spores. GsmA proteins have one or two SH3 domains N-terminal to the hydrolase domain.
smart00047	LYZ2	1.13e-24	78	229	9	147	Lysozyme subfamily 2. Eubacterial enzymes distantly related to eukaryotic lysozymes.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QEZ68765.1	1.35e-58	55	229	40	217
CEK39773.1	3.64e-56	55	229	40	217
AUN13203.1	5.16e-56	55	229	40	217
QYE98430.1	7.30e-56	55	229	40	217
CEJ75314.1	1.03e-55	55	229	40	217

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3FI7_A	6.18e-17	76	229	29	183	CrystalStructure of the autolysin Auto (Lmo1076) from Listeria monocytogenes, catalytic domain [Listeria monocytogenes EGD-e]
5DN4_A	7.28e-17	79	237	5	159	Structureof the glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]
5DN5_A	1.02e-16	79	222	5	147	Structureof a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],5DN5_B Structure of a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],5DN5_C Structure of a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]
5T1Q_A	6.33e-14	79	231	62	214	ChainA, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_B Chain B, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_C Chain C, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_D Chain D, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O32083	2.42e-26	69	229	44	198	Exo-glucosaminidase LytG OS=Bacillus subtilis (strain 168) OX=224308 GN=lytG PE=1 SV=1
P75942	7.05e-17	80	222	152	293	Peptidoglycan hydrolase FlgJ OS=Escherichia coli (strain K12) OX=83333 GN=flgJ PE=3 SV=1
P58231	7.05e-17	80	222	152	293	Peptidoglycan hydrolase FlgJ OS=Escherichia coli O157:H7 OX=83334 GN=flgJ PE=3 SV=1
Q9KQ15	1.19e-16	80	227	164	313	Peptidoglycan hydrolase FlgJ OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) OX=243277 GN=flgJ PE=3 SV=2
Q9X9J3	1.27e-16	78	222	161	304	Peptidoglycan hydrolase FlgJ OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) OX=223926 GN=flgJ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999947	0.000059	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
40	62