CAZyme Information: MGYG000001602_00787

Basic Information

• Species: Blautia sp900547685
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Blautia; Blautia sp900547685
• CAZyme ID: MGYG000001602_00787
• CAZy Family: GH85
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1234	MGYG000001602_12|CGC2	139104.44	4.2959

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001602	2582611	MAG	China	Asia

• Gene Location: Start: 40100; End: 43804 Strand: +

Full Sequence      

MSKMRKKKGKKVLPCMLATTMLLGSVNLLEVLATDSIPMTGEQARKTNQPRFNGYRIWDI
RDWTPEADEGSEFLVAKVPLQKRNKEYKPTQVNPNLDSNGQIMLMQGDYGNSFVDGMMYN
NTFGYHTLNYWQYVDYFSPWHGAASQDSPVSLYDWEYENKEASRGWEKRYFEFGVLNIPN
PAYTNAAHKNGVMSIACLYFDQYYRPGQTINELFVMDEDGTFPVAEKLIEMAEYFGYDGY
FFNAEEAVYPEYSERKKKFLARLEEAGLYTQYYDTNSYMNESKAGWLESEIDGVPTKIQD
SVFVNYGWPGSFDSQLEWMKENNIDPYEQAFYGIECLQGKFNGGHGTSSRIEELYTNDDG
TKSLKSSVALFTPSDFYQRDLDDGKLQNTNYQWMIAERERMFFSGVKSDPTNTGDQKGYG
RPDVQVDDAGNWPGVADFSAERSVIDGTTFYSNFNVGKGVQYFVNGEVSSDEEWSNINIQ
DILPTWQWWIDSEEDSKLSADFDYGSKEVRKDVSGKDMTLPYTQVGAYEGGSSLVVYGDV
DAKNKLHLFKTDLEVKDSSKASITFRKTSNDDVSMKLGVILKDGESTSMEELEIADSTAK
GGWITSEVDLSQYAGKNIAALGLVFDGQAKGYQMNIGGIKVTDGGNYTPAAPTNFGVDRN
FVDDEMIVTWDLGNFDTVDKYEIYANLSNGEKVFVGGIFDNVYYIKNLKETNAVTLELVA
VGKDGSRSEAAKYKVDYNKSVKDLAVASEEKEISVHDTAVVKGKLVQSKEEGALNLSWTN
PSVDYDHLEIEVTMDDSADTEAWTMTVPKGQSEARIEVPRYNGEQYNVAVTVVFANGSKG
EPVNVTGKVKDTYSMPFTYDGENIRIEGTRLTVWCPQSPDWFKLHISLDGEYVQFRNGFN
AFTAPHAIRAATTMKASSALPATEGMLEVVVEDYAGNMSEPCRMYLKNGVLTNKQKLNAL
IAEAEALDFTQYTESTVEPVKAALEEAKAVQEKDKAEQTEIDAAAEKLSKAMEGLEKKNG
WVETEKGWMYYEDGEKAIGWKDLSGTWYYFNKDGIMETGWVSVGGHWYYLNTDGVMETGW
LQLEDTWYYLNADGVMETGWVQVGNTWYHLDNSGVMETGWVSVGGHWYYLNTDGAMKTGW
VLVEGHWYYLNEDGVMETGWVQVGNTWYHLDNSGVMETGWVSVGGHWYYLNTDGSMETGW
VQVGSDWYYMNTDGTMATSKWIDGYYVDASGKMA

Enzyme Prediction     

No EC number prediction in MGYG000001602_00787.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH85	106	463	1.5e-63	0.9936507936507937

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
NF033930	pneumo_PspA	1.15e-80	1039	1234	444	643	pneumococcal surface protein A. The pneumococcal surface protein proteins, found in Streptococcus pneumoniae, are repetitive, with patterns of localized high sequence identity across pairs of proteins given different specific names that recombination may be presumed. This protein, PspA, has an N-terminal region that lacks a cross-wall-targeting YSIRK type extended signal peptide, in contrast to the closely related choline-binding protein CbpA which has a similar C-terminus but a YSIRK-containing region at the N-terminus.
NF033930	pneumo_PspA	3.06e-79	1018	1231	442	657	pneumococcal surface protein A. The pneumococcal surface protein proteins, found in Streptococcus pneumoniae, are repetitive, with patterns of localized high sequence identity across pairs of proteins given different specific names that recombination may be presumed. This protein, PspA, has an N-terminal region that lacks a cross-wall-targeting YSIRK type extended signal peptide, in contrast to the closely related choline-binding protein CbpA which has a similar C-terminus but a YSIRK-containing region at the N-terminus.
NF033838	PspC_subgroup_1	2.06e-74	1039	1232	487	681	pneumococcal surface protein PspC, choline-binding form. The pneumococcal surface protein PspC, as described in Streptococcus pneumoniae, is a repetitive and highly variable protein, recognized by a conserved N-terminal domain and also by genomic location. This form, subgroup 1, has variable numbers of a choline-binding repeat in the C-terminal region, and is also known as choline-binding protein A. The other form, subgroup 2, is anchored covalently after cleavage by sortase at a C-terminal LPXTG site.
NF033930	pneumo_PspA	8.99e-73	1058	1233	443	621	pneumococcal surface protein A. The pneumococcal surface protein proteins, found in Streptococcus pneumoniae, are repetitive, with patterns of localized high sequence identity across pairs of proteins given different specific names that recombination may be presumed. This protein, PspA, has an N-terminal region that lacks a cross-wall-targeting YSIRK type extended signal peptide, in contrast to the closely related choline-binding protein CbpA which has a similar C-terminus but a YSIRK-containing region at the N-terminus.
NF033838	PspC_subgroup_1	1.75e-68	1057	1234	485	666	pneumococcal surface protein PspC, choline-binding form. The pneumococcal surface protein PspC, as described in Streptococcus pneumoniae, is a repetitive and highly variable protein, recognized by a conserved N-terminal domain and also by genomic location. This form, subgroup 1, has variable numbers of a choline-binding repeat in the C-terminal region, and is also known as choline-binding protein A. The other form, subgroup 2, is anchored covalently after cleavage by sortase at a C-terminal LPXTG site.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AQP47875.1	1.44e-238	18	984	10	951
AVM41738.1	5.67e-223	49	952	72	947
SMF77083.1	3.91e-220	29	940	21	916
VEG55861.1	2.72e-213	32	949	28	941
AMN36044.1	7.84e-210	36	941	31	908

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2W91_A	2.12e-62	46	746	5	643	Structureof a Streptococcus pneumoniae family 85 glycoside hydrolase, Endo-D. [Streptococcus pneumoniae TIGR4],2W92_A Structure of a Streptococcus pneumoniae family 85 glycoside hydrolase, Endo-D, in complex with NAG-thiazoline. [Streptococcus pneumoniae TIGR4]
3GDB_A	5.79e-62	37	795	150	847	Crystalstructure of Spr0440 glycoside hydrolase domain, Endo-D from Streptococcus pneumoniae R6 [Streptococcus pneumoniae R6]
3FHA_A	2.27e-47	48	730	4	611	ChainA, Endo-beta-N-acetylglucosaminidase [Glutamicibacter protophormiae],3FHA_B Chain B, Endo-beta-N-acetylglucosaminidase [Glutamicibacter protophormiae],3FHA_C Chain C, Endo-beta-N-acetylglucosaminidase [Glutamicibacter protophormiae],3FHA_D Chain D, Endo-beta-N-acetylglucosaminidase [Glutamicibacter protophormiae]
3FHQ_A	3.05e-47	48	730	4	611	ChainA, Endo-beta-N-acetylglucosaminidase [Glutamicibacter protophormiae],3FHQ_B Chain B, Endo-beta-N-acetylglucosaminidase [Glutamicibacter protophormiae],3FHQ_D Chain D, Endo-beta-N-acetylglucosaminidase [Glutamicibacter protophormiae],3FHQ_F Chain F, Endo-beta-N-acetylglucosaminidase [Glutamicibacter protophormiae]
2VTF_A	1.43e-46	48	730	9	616	X-raycrystal structure of the Endo-beta-N-acetylglucosaminidase from Arthrobacter protophormiae E173Q mutant reveals a TIM barrel catalytic domain and two ancillary domains [Glutamicibacter protophormiae],2VTF_B X-ray crystal structure of the Endo-beta-N-acetylglucosaminidase from Arthrobacter protophormiae E173Q mutant reveals a TIM barrel catalytic domain and two ancillary domains [Glutamicibacter protophormiae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9SRL4	1.73e-16	170	581	108	477	Cytosolic endo-beta-N-acetylglucosaminidase 2 OS=Arabidopsis thaliana OX=3702 GN=ENGASE2 PE=1 SV=1
A1L251	6.59e-13	59	484	70	414	Cytosolic endo-beta-N-acetylglucosaminidase OS=Danio rerio OX=7955 GN=engase PE=2 SV=1
Q8BX80	1.60e-10	35	398	60	380	Cytosolic endo-beta-N-acetylglucosaminidase OS=Mus musculus OX=10090 GN=Engase PE=1 SV=1
P0C7A1	9.54e-09	59	484	90	432	Cytosolic endo-beta-N-acetylglucosaminidase OS=Gallus gallus OX=9031 GN=ENGASE PE=1 SV=1
Q8NFI3	4.39e-07	35	597	68	531	Cytosolic endo-beta-N-acetylglucosaminidase OS=Homo sapiens OX=9606 GN=ENGASE PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000599	0.998367	0.000495	0.000200	0.000158	0.000148

TMHMM  Annotations     

start	end
12	34