CAZyme Information: MGYG000001603_00093

Basic Information

• Species: UMGS1370 sp900551135
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; UMGS1370; UMGS1370 sp900551135
• CAZyme ID: MGYG000001603_00093
• CAZy Family: CE8
• CAZyme Description: Pectinesterase A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
327		36509.15	4.9188

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001603	2462371	MAG	China	Asia

• Gene Location: Start: 43381; End: 44364 Strand: +

Full Sequence      

MKQRIVVAKDGSGDVASVAEAAALVSPENRDWVTIYIKPGVYKERIELTSPYIILEGEDA
ENTVITGNLYAKMDMEDGMKRGTFRTYTVFIDTHDVIVKNLTIENSAGPGTRVGQAIALY
ADGDRLVFEGCRILANQDTLFTGPLPPKEIEKNGFIGPKQYAPRINGRHYYKGCLIRGEV
DFIFGSATAYFEDCELFSVNTGQEINGYVTAASTPEGQEYGYVFRHCRFTSDCPPETVYL
GRPWRDFAKTVIVNSELGSHICKEGWHDWDKVPARKTVFFGEYGNTGAGSDMKYRPNWVI
RMTEQEAERCSAETVLSGNDGWNPIVL

Enzyme Prediction     

No EC number prediction in MGYG000001603_00093.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE8	5	317	2.2e-94	0.9895833333333334

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4677	PemB	2.28e-77	4	319	82	405	Pectin methylesterase and related acyl-CoA thioesterases [Carbohydrate transport and metabolism, Lipid transport and metabolism].
pfam01095	Pectinesterase	3.19e-71	5	319	2	298	Pectinesterase.
PLN02432	PLN02432	8.93e-59	5	307	13	277	putative pectinesterase
PLN02773	PLN02773	1.30e-57	1	309	2	289	pectinesterase
PLN02301	PLN02301	2.85e-57	1	298	234	510	pectinesterase/pectinesterase inhibitor

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SET76962.1	4.78e-153	7	324	4	321
QRP39805.1	2.81e-150	4	324	17	349
ASN95501.1	2.81e-150	4	324	17	349
ANU50094.1	2.57e-148	4	324	16	348
QQR01004.1	2.57e-148	4	324	16	348

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1XG2_A	6.98e-45	6	298	6	277	ChainA, Pectinesterase 1 [Solanum lycopersicum]
1GQ8_A	5.99e-43	5	298	9	281	Pectinmethylesterase from Carrot [Daucus carota]
2NSP_A	7.63e-29	6	324	7	339	ChainA, Pectinesterase A [Dickeya dadantii 3937],2NSP_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NST_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NST_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT6_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT6_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT9_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT9_B Chain B, Pectinesterase A [Dickeya dadantii 3937]
3UW0_A	1.46e-27	6	275	34	309	Pectinmethylesterase from Yersinia enterocolitica [Yersinia enterocolitica subsp. enterocolitica 8081]
5C1C_A	1.80e-27	35	295	38	271	CrystalStructure of the Pectin Methylesterase from Aspergillus niger in Deglycosylated Form [Aspergillus niger ATCC 1015]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O23447	9.85e-47	1	324	388	692	Putative pectinesterase/pectinesterase inhibitor 43 OS=Arabidopsis thaliana OX=3702 GN=PME43 PE=2 SV=1
Q1JPL7	4.86e-46	5	318	247	542	Pectinesterase/pectinesterase inhibitor 18 OS=Arabidopsis thaliana OX=3702 GN=PME18 PE=1 SV=3
Q43143	3.57e-45	5	307	273	559	Pectinesterase/pectinesterase inhibitor U1 OS=Solanum lycopersicum OX=4081 GN=PMEU1 PE=2 SV=1
Q8GXA1	2.09e-44	1	324	254	558	Probable pectinesterase/pectinesterase inhibitor 23 OS=Arabidopsis thaliana OX=3702 GN=PME23 PE=2 SV=3
O49298	6.40e-44	2	319	248	540	Probable pectinesterase/pectinesterase inhibitor 6 OS=Arabidopsis thaliana OX=3702 GN=PME6 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000057	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001603_00093.