CAZyme Information: MGYG000001603_00626

Basic Information

• Species: UMGS1370 sp900551135
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; UMGS1370; UMGS1370 sp900551135
• CAZyme ID: MGYG000001603_00626
• CAZy Family: GH1
• CAZyme Description: Aryl-phospho-beta-D-glucosidase BglH

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
475	MGYG000001603_19|CGC1	54513.6	4.8267

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001603	2462371	MAG	China	Asia

• Gene Location: Start: 13212; End: 14639 Strand: +

Full Sequence      

MGRLPEGFLWGGATAANQCEGGYDKGGRGLANVDLIPAGPDRRPVMQGIRKMLECEEGYF
YPGHEAIDMYSHFKEDIALFAEMGFKCYRLSIAWTRIYPNGFDEEPNEEGLRFYEELFDE
CHKYGIEPLVTIVHFDAPVACTKKFGSWKSREMIDLYVKYCKTLFTRYKGKVHYWLTFNE
INMILHLPFMAAGILFEEGENQEESKYRAAHHELVASALATRLAHEIDPENQIGCMLAAG
QYYAYTCDPRDQFEALNKNRDNFFFIDVQSRGEYPPYALKFFERKGYHIGITEEDEKILA
ENPVDFISFSYYSSRLTSAEPEKYGQTSGNAFATLRNPYLKASEWGWQIDPLGLRITLNE
LYDRYQKPLFIVENGLGAVDIPDENGVINDQYRIDYLKAHIQAMEDAVEIDGVDLMGYTP
WGCIDLVSASTGEMKKRYGFIYVDKDNEGKGTLKRSRKASFDWYKKVIASNGEEL

Enzyme Prediction     

EC	3.2.1.86	3.2.1.21	3.2.1.37

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH1	3	472	5.7e-144	0.9883449883449883

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK09589	celA	0.0	1	475	1	476	6-phospho-beta-glucosidase; Reviewed
PRK09852	PRK09852	0.0	1	475	1	473	cryptic 6-phospho-beta-glucosidase; Provisional
PRK15014	PRK15014	0.0	4	475	6	477	6-phospho-beta-glucosidase BglA; Provisional
COG2723	BglB	0.0	1	474	1	456	Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase [Carbohydrate transport and metabolism].
PRK09593	arb	0.0	4	475	6	477	6-phospho-beta-glucosidase; Reviewed

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AGD88872.1	2.96e-274	4	475	3	474
QIF77575.1	3.16e-271	4	475	3	474
AVD42908.1	3.16e-271	4	475	3	474
QQY54163.1	3.16e-271	4	475	3	474
QQY47508.1	3.16e-271	4	475	3	474

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6WGD_A	1.68e-207	3	475	7	469	Crystalstructure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis],6WGD_B Crystal structure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis],6WGD_C Crystal structure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis]
4F66_A	1.54e-186	1	475	4	480	Thecrystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 in complex with beta-D-glucose-6-phosphate. [Streptococcus mutans],4F66_B The crystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 in complex with beta-D-glucose-6-phosphate. [Streptococcus mutans]
4F79_A	4.40e-186	1	475	4	480	Thecrystal structure of 6-phospho-beta-glucosidase mutant (E375Q) in complex with Salicin 6-phosphate [Streptococcus mutans],4GPN_A The crystal structure of 6-P-beta-D-Glucosidase (E375Q mutant) from Streptococcus mutans UA150 in complex with Gentiobiose 6-phosphate. [Streptococcus mutans UA159],4GPN_B The crystal structure of 6-P-beta-D-Glucosidase (E375Q mutant) from Streptococcus mutans UA150 in complex with Gentiobiose 6-phosphate. [Streptococcus mutans UA159]
2XHY_A	8.55e-186	4	475	8	479	CrystalStructure of E.coli BglA [Escherichia coli K-12],2XHY_B Crystal Structure of E.coli BglA [Escherichia coli K-12],2XHY_C Crystal Structure of E.coli BglA [Escherichia coli K-12],2XHY_D Crystal Structure of E.coli BglA [Escherichia coli K-12]
3PN8_A	1.80e-180	3	475	6	480	Thecrystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 [Streptococcus mutans],3PN8_B The crystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 [Streptococcus mutans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P24240	1.20e-215	1	475	1	473	6-phospho-beta-glucosidase AscB OS=Escherichia coli (strain K12) OX=83333 GN=ascB PE=3 SV=2
P40740	1.55e-200	3	475	7	469	Aryl-phospho-beta-D-glucosidase BglH OS=Bacillus subtilis (strain 168) OX=224308 GN=bglH PE=1 SV=2
Q46130	2.32e-186	4	475	7	471	6-phospho-beta-glucosidase OS=Clostridium longisporum OX=1523 GN=abgA PE=3 SV=1
Q46829	4.68e-185	4	475	8	479	6-phospho-beta-glucosidase BglA OS=Escherichia coli (strain K12) OX=83333 GN=bglA PE=1 SV=2
P42973	1.35e-179	1	475	1	479	Aryl-phospho-beta-D-glucosidase BglA OS=Bacillus subtilis (strain 168) OX=224308 GN=bglA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000047	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001603_00626.