CAZyme Information: MGYG000001603_01348

Basic Information

• Species: UMGS1370 sp900551135
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; UMGS1370; UMGS1370 sp900551135
• CAZyme ID: MGYG000001603_01348
• CAZy Family: CBM50
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
523	MGYG000001603_65|CGC1	57728.61	4.2038

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001603	2462371	MAG	China	Asia

• Gene Location: Start: 9323; End: 10894 Strand: +

Full Sequence      

MELRKQQIHMNRWKGNVTTQVTLDDDFIVPDTMDDMEQVLLDNGEIQIESVKNQGEKVLV
KGKLDFQVLYRRAEGGLQTLGGTVPFEEVINVPGLEERDDVTLSSELEDLSTGMVNSRKL
GVKAIVTLEVRVESLYQAEAAEDAGEGGSSAGTMDNVLLRHRTIDLAAIAARHKDTFRIK
EQISLSGSKPNIEQLLWKEMRLCGVSARPAEDKMRIDGNLEVFVIYSGEGEDTPVQWWEE
TIPFSGEIELAGSGEEMIPVVAMGLAHKNVEAHPDYDGEMRELDVEAVLELDMKLYEEQQ
IQILSDLYATDRELTPVAAEACFEQILTKNGCKCRVTEKVSMDQNQRILQICHSGGTVKV
DDISVGENQLIIDGAVEVSLLYLTSDDSAPIQSAVRMAPFHCEAEAAGIREDSIYQVTPG
LEQLTAVMAGGDSVEIKAVASLDVLVLQPVCESVIVDVTEQPLDVKKLQEMPGIVGYIVQ
PGDSLWKIAKKFHTTVESIMSMNELTSDEIRPGDRLILVKEVA

Enzyme Prediction     

No EC number prediction in MGYG000001603_01348.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam12673	DUF3794	2.27e-17	35	115	1	80	Domain of unknown function (DUF3794). This presumed domain is functionally uncharacterized. This domain family is found in bacteria, and is approximately 90 amino acids in length. The family is found in association with pfam01476.
pfam12673	DUF3794	9.53e-16	191	272	1	79	Domain of unknown function (DUF3794). This presumed domain is functionally uncharacterized. This domain family is found in bacteria, and is approximately 90 amino acids in length. The family is found in association with pfam01476.
pfam01476	LysM	1.34e-14	477	518	1	42	LysM domain. The LysM (lysin motif) domain is about 40 residues long. It is found in a variety of enzymes involved in bacterial cell wall degradation. This domain may have a general peptidoglycan binding function. The structure of this domain is known.
pfam12673	DUF3794	3.59e-14	348	428	2	79	Domain of unknown function (DUF3794). This presumed domain is functionally uncharacterized. This domain family is found in bacteria, and is approximately 90 amino acids in length. The family is found in association with pfam01476.
cd00118	LysM	6.71e-13	477	518	3	45	Lysin Motif is a small domain involved in binding peptidoglycan. LysM, a small globular domain with approximately 40 amino acids, is a widespread protein module involved in binding peptidoglycan in bacteria and chitin in eukaryotes. The domain was originally identified in enzymes that degrade bacterial cell walls, but proteins involved in many other biological functions also contain this domain. It has been reported that the LysM domain functions as a signal for specific plant-bacteria recognition in bacterial pathogenesis. Many of these enzymes are modular and are composed of catalytic units linked to one or several repeats of LysM domains. LysM domains are found in bacteria and eukaryotes.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ASN93744.1	4.82e-242	1	523	1	534
QRP41598.1	4.82e-242	1	523	1	534
QJU21944.1	2.77e-241	1	523	1	534
QQQ98613.1	3.50e-237	1	523	1	534
ANU46673.1	3.50e-237	1	523	1	534

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
C0H403	9.81e-06	477	521	31	74	Uncharacterized protein YkzQ OS=Bacillus subtilis (strain 168) OX=224308 GN=ykzQ PE=4 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000074	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001603_01348.