CAZyme Information: MGYG000001603_01653

Basic Information

• Species: UMGS1370 sp900551135
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; UMGS1370; UMGS1370 sp900551135
• CAZyme ID: MGYG000001603_01653
• CAZy Family: CE12
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
603		68951.06	5.0623

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001603	2462371	MAG	China	Asia

• Gene Location: Start: 5433; End: 7244 Strand: +

Full Sequence      

MTEYRFTNQWEQDSTNKNMVKRLFASNLYGEENGAGFLPELEETAAEDFYTGTAGWIPGG
NGKKEEGIMRRDCPDGVEINSEHYPLRFGIPVKHTGRYRITVEICGGREGLSGLTLSVGR
RNIVERNLSIPANRVYRKTFYYGVYPYRPVVREDEPTTDFMIGISVLGKRARLSRVCVEY
CDETGERVPLLFIGGDSTVRDYEGLYPYNPLTNGGSWGQNLLQYLDGMAVCNQAHSGLTT
NCFRQDGHWELVKAGIREGDVFLFGFGHNDQKRRNLKAYDQFASNIRRYVMETRMLGGIP
VLATPMSRIPVQDGDSWYDLLEAYADSIRQIGREMNVPVIDLHSLTFQLFCSMGAKVCQN
YFNDTTHVNDYGGALLADMMAQEIRRLRIEPLCSHMNHTVFHAWEPDLSLRPQGQMESSQ
IEERPNLSTELPELPYEDCRNLDEKDVMTLKKAMKYGLLDPCVRYLHPLEEMPRAQFVFL
FLKAIKPALRRPWQGNYCDLSRYEYDAEQIQAALDENLIDFETTPNHCFRPDDSLTLEEL
VSFAVRGLHSWTERNLGLSECIKEAQELGWIEASGLELGRTVTRAESIEMTVKMYCEKGG
RLE

Enzyme Prediction     

No EC number prediction in MGYG000001603_01653.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE12	191	384	2e-46	0.9904761904761905

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd01821	Rhamnogalacturan_acetylesterase_like	8.37e-57	189	384	1	198	Rhamnogalacturan_acetylesterase_like subgroup of SGNH-hydrolases. Rhamnogalacturan acetylesterase removes acetyl esters from rhamnogalacturonan substrates, and renders them susceptible to degradation by rhamnogalacturonases. Rhamnogalacturonans are highly branched regions in pectic polysaccharides, consisting of repeating -(1,2)-L-Rha-(1,4)-D-GalUA disaccharide units, with many rhamnose residues substituted by neutral oligosaccharides such as arabinans, galactans and arabinogalactans. Extracellular enzymes participating in the degradation of plant cell wall polymers, such as Rhamnogalacturonan acetylesterase, would typically be found in saprophytic and plant pathogenic fungi and bacteria.
pfam13472	Lipase_GDSL_2	2.35e-11	195	345	3	150	GDSL-like Lipase/Acylhydrolase family. This family of presumed lipases and related enzymes are similar to pfam00657.
cd00229	SGNH_hydrolase	3.56e-11	190	382	1	186	SGNH_hydrolase, or GDSL_hydrolase, is a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the typical Ser-His-Asp(Glu) triad from other serine hydrolases, but may lack the carboxlic acid.
cd01834	SGNH_hydrolase_like_2	2.33e-10	260	382	63	190	SGNH_hydrolase subfamily. SGNH hydrolases are a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
COG2755	TesA	2.02e-08	188	392	8	216	Lysophospholipase L1 or related esterase [Amino acid transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKS48637.1	7.97e-171	4	594	6	584
ASA21604.1	1.50e-170	20	594	16	582
AOZ96642.1	6.67e-101	92	571	47	523
ADL33886.1	6.22e-95	92	598	54	558
APC40119.1	2.27e-54	23	396	20	402

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O31523	1.45e-22	191	396	8	223	Rhamnogalacturonan acetylesterase RhgT OS=Bacillus subtilis (strain 168) OX=224308 GN=rhgT PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000054	0.000004	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001603_01653.