CAZyme Information: MGYG000001603_01842

Basic Information

• Species: UMGS1370 sp900551135
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; UMGS1370; UMGS1370 sp900551135
• CAZyme ID: MGYG000001603_01842
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
421		48947.97	7.3632

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001603	2462371	MAG	China	Asia

• Gene Location: Start: 1543; End: 2808 Strand: +

Full Sequence      

MVVKILQGYMIFIIILMLLYTIRHFIFSVNRLLGRQRIYYNDIYASQMKTISVLIPMHNE
EQVLSYVLDALLECDYDRDRLEIIPINDNSTDRTKELLEEYHRKYEFIRPIHRDCPDRGK
PAGLNDAMAAARGEIVIVFDADYRPAKDMLKQLAIAFEDPEVGAVMGRVIPYNTNKNLLT
RLINLERSGGYQVDQQARYNLRLIPQYGGTVGGFRKDLMLELGGFNPLVLAEDTELTFRL
YTHGWKVIYANSAECYEEAPETWEVRARQIRRWSRGHNQVLFRYFFRSIFTPNMNLREKF
DGMFLLFVYAVPFFLLLGQLASYSLFLLGEMDLFAGWWALLFVGVYCSFGNFAPFYEIGS
ALMLDGLKGEILLLPLIMFNFYFYMWNISLGFLDAIWDAVTKRKVTWAKTARFAKAEKGG
A

Enzyme Prediction     

No EC number prediction in MGYG000001603_01842.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	51	276	2e-34	0.9826086956521739

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1215	BcsA	2.42e-62	8	416	13	422	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
cd06423	CESA_like	5.26e-60	53	233	1	180	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.
cd06437	CESA_CaSu_A2	1.67e-44	51	276	3	231	Cellulose synthase catalytic subunit A2 (CESA2) is a catalytic subunit or a catalytic subunit substitute of the cellulose synthase complex. Cellulose synthase (CESA) catalyzes the polymerization reaction of cellulose using UDP-glucose as the substrate. Cellulose is an aggregate of unbranched polymers of beta-1,4-linked glucose residues, which is an abundant polysaccharide produced by plants and in varying degrees by several other organisms including algae, bacteria, fungi, and even some animals. Genomes from higher plants harbor multiple CESA genes. There are ten in Arabidopsis. At least three different CESA proteins are required to form a functional complex. In Arabidopsis, CESA1, 3 and 6 and CESA4, 7 and 8, are required for cellulose biosynthesis during primary and secondary cell wall formation. CESA2 is very closely related to CESA6 and is viewed as a prime substitute for CESA6. They functionally compensate each other. The cesa2 and cesa6 double mutant plants were significantly smaller, while the single mutant plants were almost normal.
cd06439	CESA_like_1	4.51e-38	9	276	2	248	CESA_like_1 is a member of the cellulose synthase (CESA) superfamily. This is a subfamily of cellulose synthase (CESA) superfamily. CESA superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members of the superfamily include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins.
cd06427	CESA_like_2	9.06e-38	50	282	2	235	CESA_like_2 is a member of the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, Glucan Biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of glucan.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNM08864.1	4.34e-264	1	413	1	413
QWT56260.1	8.01e-222	1	418	1	418
QNB48280.1	1.05e-216	17	420	1	404
QNP78262.1	6.77e-181	7	420	10	423
ADO44672.1	1.17e-175	5	413	7	416

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6YV7_B	5.66e-21	51	269	44	262	MannosyltransferasePcManGT from Pyrobaculum calidifontis [Pyrobaculum calidifontis JCM 11548],6YV8_B Mannosyltransferase PcManGT from Pyrobaculum calidifontis in complex with GDP and Mn2+ [Pyrobaculum calidifontis JCM 11548],6YV9_A Mannosyltransferase PcManGT from Pyrobaculum calidifontis in complex with GDP-Man and Mn2+ [Pyrobaculum calidifontis JCM 11548]
6YV7_A	5.73e-21	51	269	45	263	MannosyltransferasePcManGT from Pyrobaculum calidifontis [Pyrobaculum calidifontis JCM 11548],6YV8_A Mannosyltransferase PcManGT from Pyrobaculum calidifontis in complex with GDP and Mn2+ [Pyrobaculum calidifontis JCM 11548],6YV9_B Mannosyltransferase PcManGT from Pyrobaculum calidifontis in complex with GDP-Man and Mn2+ [Pyrobaculum calidifontis JCM 11548]
5EJ1_A	8.42e-15	47	281	126	379	ChainA, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1]
4HG6_A	8.87e-15	47	281	138	391	ChainA, Cellulose Synthase Subunit A [Cereibacter sphaeroides]
4P00_A	8.88e-15	47	281	139	392	ChainA, Cellulose Synthase A subunit [Cereibacter sphaeroides 2.4.1],4P02_A Chain A, Cellulose Synthase subunit A [Cereibacter sphaeroides 2.4.1],5EIY_A Chain A, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1],5EJZ_A Chain A, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P96587	7.74e-52	47	419	47	420	Uncharacterized glycosyltransferase YdaM OS=Bacillus subtilis (strain 168) OX=224308 GN=ydaM PE=3 SV=1
Q9SJA2	2.04e-31	46	308	224	493	Probable xyloglucan glycosyltransferase 8 OS=Arabidopsis thaliana OX=3702 GN=CSLC8 PE=2 SV=1
Q9SB75	2.78e-31	46	354	224	541	Probable xyloglucan glycosyltransferase 5 OS=Arabidopsis thaliana OX=3702 GN=CSLC5 PE=1 SV=1
Q8LIY0	5.05e-31	45	308	229	499	Probable xyloglucan glycosyltransferase 1 OS=Oryza sativa subsp. japonica OX=39947 GN=CSLC1 PE=3 SV=1
Q9ZQB9	1.28e-30	51	308	243	507	Probable xyloglucan glycosyltransferase 12 OS=Arabidopsis thaliana OX=3702 GN=CSLC12 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000023	0.000015	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
5	27
305	327
334	356
371	393