CAZyme Information: MGYG000001603_02006

Basic Information

• Species: UMGS1370 sp900551135
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; UMGS1370; UMGS1370 sp900551135
• CAZyme ID: MGYG000001603_02006
• CAZy Family: GH105
• CAZyme Description: Unsaturated rhamnogalacturonyl hydrolase YesR

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
357		41321.38	4.6836

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001603	2462371	MAG	China	Asia

• Gene Location: Start: 1500; End: 2573 Strand: +

Full Sequence      

MSVYENRLNLVADAMLTMKNNGIEEKFPISLIDIDCWEWPQGVGLYGLYKYYEFSKDEKI
LNFLIQWFDDRIKEGILEKNVNTTAPMLTLSYVYEITGKEEYLDLIKEWTAWIMEEKGLI
RTGDGCFQHMITKNPNQGEILIDTLFMTVLFLARAGVILHRQDCIDEANYQFLQHIKYLL
NKQEGLFYHGFNFDRNNNYGEIMWGRGNSWYTVAIMDYMEMADLDEGLKRHFLTVYENQV
KALKKYADSEEGLWHTVINDSSSYIELSASAGFLCGMMKGIRKGVISKDEYGATVQKALS
HLLDYIGEDGVVKNVSYGTPIGENAEFYKNIICCPMTYGQAMMIMALQEAMRYTTER

Enzyme Prediction     

No EC number prediction in MGYG000001603_02006.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	36	352	1e-94	0.963855421686747

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4225	YesR	2.35e-93	5	352	6	351	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].
pfam07470	Glyco_hydro_88	3.35e-80	13	353	5	342	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCJ94867.1	6.42e-189	8	351	11	354
SET87383.1	4.34e-171	5	351	8	354
AGX06452.1	1.16e-132	5	357	9	358
ANY67857.1	1.60e-131	7	354	10	353
APO45381.1	2.27e-131	3	355	6	354

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3PMM_A	9.42e-83	37	352	66	379	ChainA, Putative cytoplasmic protein [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]
3QWT_A	1.45e-81	37	352	65	378	ChainA, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_B Chain B, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_C Chain C, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_D Chain D, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A]
4XUV_A	1.95e-70	7	352	11	370	Crystalstructure of a glycoside hydrolase family 105 (GH105) enzyme from Thielavia terrestris [Thermothielavioides terrestris NRRL 8126],4XUV_B Crystal structure of a glycoside hydrolase family 105 (GH105) enzyme from Thielavia terrestris [Thermothielavioides terrestris NRRL 8126]
4WU0_A	9.04e-23	35	312	21	311	StructuralAnalysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824],4WU0_B Structural Analysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824]
3K11_A	1.88e-11	121	328	183	387	Crystalstructure of Putative glycosyl hydrolase (NP_813087.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 1.80 A resolution [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O31521	4.87e-47	37	331	29	315	Unsaturated rhamnogalacturonyl hydrolase YesR OS=Bacillus subtilis (strain 168) OX=224308 GN=yesR PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000050	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001603_02006.