CAZyme Information: MGYG000001604_00474

Basic Information

• Species: Barnesiella sp002159975
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Barnesiellaceae; Barnesiella; Barnesiella sp002159975
• CAZyme ID: MGYG000001604_00474
• CAZy Family: CBM20
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
893		103380.63	4.8271

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001604	2665014	MAG	China	Asia

• Gene Location: Start: 142689; End: 145370 Strand: +

Full Sequence      

MKITFEIYYHTRWGESLMLSGATEQLGSGDESRAVVMDCRGGDLWSYTIDVPATIAAFEY
RYLVKSGDSVRREWNRPHRFVPGQKAAEYRLLDRWRDTPDDLPFYSSAFTQGIFFRQHPQ
PQPGVPAAGTVTFKIFAPQLRPDEQLLMVGSVPALGNWEPSQAPALDDTEFPEWHLTLDA
AQLGPSFEYKFVVVRTQQREVVAWETGANRVYTDSENSASTAVVVLGLLFNGPERPWKGA
GTAIPVFSLRTDYGFGTGEFLDLKYLVDWALRTGQSFIQLLPVNDTTLTGSWCDSYPYNA
NSTFALHPQYLRLSEVGRLSDEARQAQFDALQRELNMQPDVDYERVNRAKMEYLNLLFDE
LGDDTLSSEGFKQFFRENKFWLQPYAAFSSLRDRFKTADFTRWGEFASYDESMIADYCAV
WSPWYRSVALYYYIQYHLHLQLSEVRDYAHRAGVVLKGDIPIGISRTSVDAWVNPDLFRM
NCQAGAPPDDFSIEGQNWGFPTYDWEVMARDGYAWWKARLRHMSRYFDAYRIDHILGFFR
IWEIPLDAVHGLLGHFHAAMPLSPDELAQKGFRFDASWQTVPYVREESLHDIFGAYTDEV
KTRFLVDKGNGRWDLNVMMDTQRKVVDYFSEADDEMNVSIRDGLLKLLDEVLFLEDPDQP
GYYHPRIMGNRTQAYQALDDEQKACFDRLYEDFFYWRHNDFWKSEALRKLPVLVASTDML
VCGEDLGMIPACVPEVMKQLQILSLEIPRMPKEWNCEFGDVSRYPVRSVCTTSTHDMSGI
RGWWQEDPARTQRYFNEVLGEPGQAPATCEPWICERMVELTLSAPSMLAILPLQDWLSID
GRLRRKNPDEERINNPACPHYYWRYRMHLSLEQLLAEGVFNTRLQEMIARSGR

Enzyme Prediction     

EC	2.4.1.25

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH77	244	888	3.1e-148	0.9878542510121457
CBM20	131	218	1.1e-22	0.9333333333333333
CBM20	2	81	2.3e-16	0.8777777777777778

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam02446	Glyco_hydro_77	0.0	244	870	1	460	4-alpha-glucanotransferase. These enzymes EC:2.4.1.25 transfer a segment of a (1,4)-alpha-D-glucan to a new 4-position in an acceptor, which may be glucose or (1,4)-alpha-D-glucan.
PLN02950	PLN02950	0.0	3	877	11	902	4-alpha-glucanotransferase
PLN03236	PLN03236	0.0	210	893	33	741	4-alpha-glucanotransferase; Provisional
COG1640	MalQ	1.15e-103	241	884	15	509	4-alpha-glucanotransferase [Carbohydrate transport and metabolism].
PRK14508	PRK14508	8.39e-92	245	893	12	496	4-alpha-glucanotransferase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AHF11508.1	0.0	1	893	1	893
QCD41142.1	0.0	1	893	1	892
QCD39232.1	0.0	1	893	1	892
QCP72924.1	0.0	1	893	1	892
QCD34909.1	0.0	1	893	1	892

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1TZ7_A	5.41e-34	240	867	24	483	Aquifexaeolicus amylomaltase [Aquifex aeolicus],1TZ7_B Aquifex aeolicus amylomaltase [Aquifex aeolicus]
6M6T_A	9.14e-29	238	544	5	307	ChainA, 4-alpha-glucanotransferase [Streptococcus agalactiae],6M6T_B Chain B, 4-alpha-glucanotransferase [Streptococcus agalactiae],6M6T_C Chain C, 4-alpha-glucanotransferase [Streptococcus agalactiae],6M6T_D Chain D, 4-alpha-glucanotransferase [Streptococcus agalactiae],6M6T_E Chain E, 4-alpha-glucanotransferase [Streptococcus agalactiae],6M6T_F Chain F, 4-alpha-glucanotransferase [Streptococcus agalactiae],6M6T_G Chain G, 4-alpha-glucanotransferase [Streptococcus agalactiae],6M6T_H Chain H, 4-alpha-glucanotransferase [Streptococcus agalactiae]
1X1N_A	1.94e-28	240	556	28	344	Structuredetermination and refinement at 1.8 A resolution of Disproportionating Enzyme from Potato [Solanum tuberosum],6LX1_A Potato D-enzyme complexed with Acarbose [Solanum tuberosum],6LX2_A Potato D-enzyme complexed with CA26 [Solanum tuberosum]
5CPQ_A	2.07e-28	215	571	38	399	Disproportionatingenzyme 1 from Arabidopsis - apo form [Arabidopsis thaliana],5CPQ_B Disproportionating enzyme 1 from Arabidopsis - apo form [Arabidopsis thaliana],5CPS_A Disproportionating enzyme 1 from Arabidopsis - maltotriose soak [Arabidopsis thaliana],5CPS_B Disproportionating enzyme 1 from Arabidopsis - maltotriose soak [Arabidopsis thaliana],5CPT_A Disproportionating enzyme 1 from Arabidopsis - beta cyclodextrin soak [Arabidopsis thaliana],5CPT_B Disproportionating enzyme 1 from Arabidopsis - beta cyclodextrin soak [Arabidopsis thaliana],5CQ1_A Disproportionating enzyme 1 from Arabidopsis - cycloamylose soak [Arabidopsis thaliana],5CQ1_B Disproportionating enzyme 1 from Arabidopsis - cycloamylose soak [Arabidopsis thaliana],5CSU_A Disproportionating enzyme 1 from Arabidopsis - acarviostatin soak [Arabidopsis thaliana],5CSU_B Disproportionating enzyme 1 from Arabidopsis - acarviostatin soak [Arabidopsis thaliana],5CSY_A Disproportionating enzyme 1 from Arabidopsis - acarbose soak [Arabidopsis thaliana],5CSY_B Disproportionating enzyme 1 from Arabidopsis - acarbose soak [Arabidopsis thaliana]
7COV_A	3.02e-28	240	556	80	396	PotatoD-enzyme, native (substrate free) [Solanum tuberosum]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8RXD9	1.45e-220	1	893	19	927	4-alpha-glucanotransferase DPE2 OS=Arabidopsis thaliana OX=3702 GN=DPE2 PE=1 SV=1
Q69Q02	4.87e-216	1	893	13	921	4-alpha-glucanotransferase DPE2 OS=Oryza sativa subsp. japonica OX=39947 GN=DPE2 PE=2 SV=1
O34022	1.18e-64	241	890	30	529	4-alpha-glucanotransferase OS=Chlamydia caviae (strain ATCC VR-813 / DSM 19441 / 03DC25 / GPIC) OX=227941 GN=malQ PE=3 SV=1
Q9Z8L2	2.04e-64	237	888	16	523	4-alpha-glucanotransferase OS=Chlamydia pneumoniae OX=83558 GN=malQ PE=3 SV=1
Q9PKU9	2.92e-60	241	887	30	526	4-alpha-glucanotransferase OS=Chlamydia muridarum (strain MoPn / Nigg) OX=243161 GN=malQ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000066	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001604_00474.