CAZyme Information: MGYG000001604_00688

Basic Information

• Species: Barnesiella sp002159975
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Barnesiellaceae; Barnesiella; Barnesiella sp002159975
• CAZyme ID: MGYG000001604_00688
• CAZy Family: GH84
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1114	MGYG000001604_5|CGC1	124627.46	4.2995

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001604	2665014	MAG	China	Asia

• Gene Location: Start: 41048; End: 44392 Strand: +

Full Sequence      

MKNIFILLTFFFSGSIFCSQAQSYTIYPTPQKVVEGENSVELSNTIHVICESSIGDVSRN
RMEEVLENAGYTIAYADKASQTETNLYLGTNGSNGAAAQYAAEHNLPLAVFDAGDNKFDP
YLLQINSNSPHGDIVVLGNSEGSEYYAFATLEQIFEQAGGNSIRQITFEDYSHTQYRGIV
EGFYGHPYSVESRLSLFEFCKRFKLNVFVYGPKSDPYHLGNWRDDYPTSLTEQQRFFGMI
TQDDLRTMTQTAKACHVDFIWAAHPGLQQGINFYDKSLMDQGIDALMTKFEHLYNLGVRG
FGVFIDDMNYTPSGSMQAYLADETQKRLRERFVTDDPDDEIAPLFFVPTAYALNYGGSYT
LNDLKSVDSEVVIAFTGYDCFSNIRASAIDDMAGRVGRNPVMWWNNPVNDDHDERIYMRE
MTTHWTIENSGAINTLNGLILNPMSQAQASKVALFGAADYSWNPNTFDVHQNWEDVFARM
ARPGDSQTAEALKCFARFSDALVEDDDMIALYDGFKSHFGGSTFPAEAAQLRTELGNLNQ
ACNYIETLKDSEYNDYRLIYEDLHCWNAKLKTLSSLALTALDILENDGTMSRAEGWEKYL
TLQQLYKGMSNDSAYLVSALEGYGTSTYEVHYEVTPGDSYLRPFVDYLVEKAGSNVPGEW
PAKDTIQIVTNLETVQGANLTTEDTSFELSGLAALTLDPDEYIGIYFGNLEKIDVPATAF
TAGIEAEVSVNGKQWTAVQLPVNEQTAAYIRLKNTSDESLTVGADRLSGSLQFTAVSGTP
TVSTNIPQYQNYALERVIDGNPSSFFWSSEAQAEGQYIMLTYPNSQPQYEITVTFTANDQ
PSGTVAIEISNDNTQWTPVAEFTAAQLDDTYSFTCNANGQSARYVRFVIRSYTGSYWLQV
AEFKSEMASKESQTADQNGKQIATLADRDLTTSYHPTAAGYIEHRFIENLNIESIEIYHN
STFDNGYELPTIYVNNGSEWVKMGHLNALCTIIDTHEMELVMAVKIEWNEENMPTLYEIL
PCGTPYVEKPGTATAIEQPASAGMRLYTRDNRLHVQANATITSLTLYDLSGRVVARYTPR
AHSFEIALDATMPRVLVARVSDSDQNISTHKIIW

Enzyme Prediction     

No EC number prediction in MGYG000001604_00688.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH84	177	496	2.2e-73	0.9932203389830508
CBM32	788	904	2.9e-16	0.8951612903225806

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07555	NAGidase	9.83e-120	177	495	1	293	beta-N-acetylglucosaminidase. This family has previously been described as a hyaluronidase. However, more recently it has been shown that this family has beta-N-acetylglucosaminidase activity.
pfam02838	Glyco_hydro_20b	5.54e-09	24	170	2	123	Glycosyl hydrolase family 20, domain 2. This domain has a zincin-like fold.
pfam00754	F5_F8_type_C	6.02e-09	781	903	3	127	F5/8 type C domain. This domain is also known as the discoidin (DS) domain family.
cd00057	FA58C	0.002	788	895	19	134	Substituted updates: Jan 31, 2002

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AHF13697.1	0.0	1	1114	1	1115
BCI64753.1	0.0	1	1113	1	1113
AHF13792.1	0.0	19	1113	4	1244
QUT77745.1	9.17e-304	1	1046	1	1043
QFQ11845.1	2.55e-130	22	1113	22	1134

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6PWI_A	3.57e-70	19	655	29	627	Structureof CpGH84D [Clostridium perfringens ATCC 13124],6PWI_B Structure of CpGH84D [Clostridium perfringens ATCC 13124]
6PV4_A	3.27e-60	24	607	32	610	Structureof CpGH84A [Clostridium perfringens ATCC 13124],6PV4_B Structure of CpGH84A [Clostridium perfringens ATCC 13124],6PV4_C Structure of CpGH84A [Clostridium perfringens ATCC 13124],6PV4_D Structure of CpGH84A [Clostridium perfringens ATCC 13124]
2VVN_A	2.97e-56	21	758	21	721	BtGH84in complex with NH-Butylthiazoline [Bacteroides thetaiotaomicron VPI-5482],2VVN_B BtGH84 in complex with NH-Butylthiazoline [Bacteroides thetaiotaomicron VPI-5482],2VVS_A BtGH84 structure in complex with PUGNAc [Bacteroides thetaiotaomicron VPI-5482],2X0H_A BtGH84 Michaelis complex [Bacteroides thetaiotaomicron VPI-5482],2X0H_B BtGH84 Michaelis complex [Bacteroides thetaiotaomicron VPI-5482],4AIS_A A complex structure of BtGH84 [Bacteroides thetaiotaomicron VPI-5482],4AIS_B A complex structure of BtGH84 [Bacteroides thetaiotaomicron VPI-5482],7OU8_AAA Chain AAA, O-GlcNAcase BT_4395 [Bacteroides thetaiotaomicron VPI-5482],7OU8_BBB Chain BBB, O-GlcNAcase BT_4395 [Bacteroides thetaiotaomicron VPI-5482]
7K41_A	5.64e-56	21	758	3	703	ChainA, O-GlcNAcase BT_4395 [Escherichia coli K-12]
2WZI_A	7.24e-56	21	758	21	721	BtGH84D243N in complex with 5F-oxazoline [Bacteroides thetaiotaomicron VPI-5482],2WZI_B BtGH84 D243N in complex with 5F-oxazoline [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P26831	1.92e-61	24	989	39	1033	Hyaluronoglucosaminidase OS=Clostridium perfringens (strain 13 / Type A) OX=195102 GN=nagH PE=1 SV=2
Q89ZI2	1.63e-55	21	758	21	721	O-GlcNAcase BT_4395 OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50) OX=226186 GN=BT_4395 PE=1 SV=1
Q0TR53	1.73e-41	28	502	48	485	O-GlcNAcase NagJ OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) OX=195103 GN=nagJ PE=1 SV=1
Q8XL08	2.12e-40	28	502	48	485	O-GlcNAcase NagJ OS=Clostridium perfringens (strain 13 / Type A) OX=195102 GN=nagJ PE=1 SV=1
O60502	3.68e-17	178	506	63	371	Protein O-GlcNAcase OS=Homo sapiens OX=9606 GN=OGA PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.002018	0.908051	0.089062	0.000346	0.000245	0.000231

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001604_00688.