CAZyme Information: MGYG000001604_01125

Basic Information

• Species: Barnesiella sp002159975
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Barnesiellaceae; Barnesiella; Barnesiella sp002159975
• CAZyme ID: MGYG000001604_01125
• CAZy Family: GT19
• CAZyme Description: Lipid-A-disaccharide synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
375	MGYG000001604_9|CGC1	42233.14	8.3931

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001604	2665014	MAG	China	Asia

• Gene Location: Start: 10824; End: 11951 Strand: +

Full Sequence      

MKYYLIAGEASGDLHASNLMKALKREDPAAEFRYFGGDLMAACGGTLVKHYRDMAYMGFI
PVLMNLDKVLANMSLCKQDIAAWRPDAVILVDYPGFNLKIVKYVKTHLNIPVYYYISPKI
WAWKEWRVKSIRRYVDRLYSILPFEVDFYARHHYAVEYVGNPTVDELAARPRADETFDDF
VTECGLERKPIIALLAGSRVAEIKNNLPLMIEAAEAYPEYQLVVAGAPGIAPELYAPYVQ
GHRVKVVEGKTYRLLQQSRAALVTSGTATLETALLRVPQVVCYWVGGGKLFYKTFEKILR
VPYVSLVNLIADAPVVCELLGYRATVENLRRELACLFDEENRERMLAGYDLVARRLGAPG
APEQAARSMVSALRG

Enzyme Prediction     

No EC number prediction in MGYG000001604_01125.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT19	4	352	5.8e-108	0.9774011299435028

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00025	lpxB	9.30e-103	1	367	2	369	lipid-A-disaccharide synthase; Reviewed
COG0763	LpxB	2.47e-99	1	367	2	373	Lipid A disaccharide synthetase [Cell wall/membrane/envelope biogenesis].
pfam02684	LpxB	1.51e-71	4	366	2	371	Lipid-A-disaccharide synthetase. This is a family of lipid-A-disaccharide synthetases, EC:2.4.2.128. These enzymes catalyze the reaction: UDP-2,3-bis(3-hydroxytetradecanoyl) glucosamine + 2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate <=> UDP + 2,3-bis(3-hydroxytetradecanoyl)-D-glucosaminyl-1,6 -beta-D-2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate. These enzymes catalyze the fist disaccharide step in the synthesis of lipid-A-disaccharide.
TIGR00215	lpxB	2.84e-58	5	370	10	383	lipid-A-disaccharide synthase. Lipid-A precursor biosynthesis producing lipid A disaccharide in a condensation reaction. transcribed as part of an operon including lpxA [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
PRK14089	PRK14089	6.91e-48	1	348	2	324	lipid-A-disaccharide synthase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AHF12800.1	1.35e-263	1	375	1	375
BCI64292.1	1.58e-180	1	373	1	374
ALJ61154.1	1.07e-167	1	373	1	376
QUT93317.1	1.51e-167	1	373	1	376
QCQ44785.1	7.87e-166	1	374	1	376

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5W8S_A	7.99e-31	5	333	11	341	LipidA Disaccharide Synthase (LpxB)-7 solubilizing mutations [Escherichia coli BL21(DE3)],5W8X_A Lipid A Disaccharide Synthase (LpxB)-7 solubilizing mutations-Bound to UDP [Escherichia coli BL21(DE3)]
5W8N_A	2.10e-30	5	333	11	341	LipidA Disaccharide Synthase (LpxB)-6 solubilizing mutations [Escherichia coli BL21(DE3)]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q1D393	2.72e-68	5	373	9	378	Lipid-A-disaccharide synthase OS=Myxococcus xanthus (strain DK1622) OX=246197 GN=lpxB PE=3 SV=1
Q2IL69	1.43e-64	5	374	13	383	Lipid-A-disaccharide synthase OS=Anaeromyxobacter dehalogenans (strain 2CP-C) OX=290397 GN=lpxB PE=3 SV=1
Q39T49	4.10e-64	5	366	11	373	Lipid-A-disaccharide synthase OS=Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15) OX=269799 GN=lpxB PE=3 SV=1
B4UHR6	3.11e-63	5	374	13	383	Lipid-A-disaccharide synthase OS=Anaeromyxobacter sp. (strain K) OX=447217 GN=lpxB PE=3 SV=1
B8JE78	3.11e-63	5	374	13	383	Lipid-A-disaccharide synthase OS=Anaeromyxobacter dehalogenans (strain 2CP-1 / ATCC BAA-258) OX=455488 GN=lpxB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000044	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001604_01125.