CAZyme Information: MGYG000001608_00653

Basic Information

• Species: Gabonibacter sp900543425
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Marinifilaceae; Gabonibacter; Gabonibacter sp900543425
• CAZyme ID: MGYG000001608_00653
• CAZy Family: GT19
• CAZyme Description: Lipid-A-disaccharide synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
380	MGYG000001608_3|CGC1	43295.47	9.0368

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001608	3329116	MAG	China	Asia

• Gene Location: Start: 73617; End: 74759 Strand: -

Full Sequence      

MKYYIIAGEASGDLHASNLIRGLRQEDPEAVIRGWGGDLMKNAGCEIVRHYKDTAIMGFL
TVLKNLGKIKENIEACRRDILAWNPDVVILVDYGGFNLRVAKFIKAAEIPVFYYISPKIW
AWNTGRVKKIKQLVDRMYVIFPFEVDFYKQFGYTVQYAGNPLVDAIHDRDHKEEEYADFI
QVNRLPDKPIIALLAGSRSQELKHVLPKMLLMVKHFPDYQFVIAGAPSMSDTDYAPYIKD
MDIRIVYGQTYRLLKQARCALVTSGTATLETAILKTPQVVCYSGEGGAFSYFLFKTFVKV
KYISLVNLIAGKEVVRELLMQKLNERNLLKALSAILPDGYARDEMLREYDEVNRRLGDAG
ASERFARMMIRDLKELKGCG

Enzyme Prediction     

No EC number prediction in MGYG000001608_00653.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT19	4	356	1e-117	0.9887005649717514

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00025	lpxB	3.14e-111	1	367	2	369	lipid-A-disaccharide synthase; Reviewed
COG0763	LpxB	2.66e-103	1	375	2	381	Lipid A disaccharide synthetase [Cell wall/membrane/envelope biogenesis].
pfam02684	LpxB	8.44e-79	4	339	2	342	Lipid-A-disaccharide synthetase. This is a family of lipid-A-disaccharide synthetases, EC:2.4.2.128. These enzymes catalyze the reaction: UDP-2,3-bis(3-hydroxytetradecanoyl) glucosamine + 2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate <=> UDP + 2,3-bis(3-hydroxytetradecanoyl)-D-glucosaminyl-1,6 -beta-D-2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate. These enzymes catalyze the fist disaccharide step in the synthesis of lipid-A-disaccharide.
TIGR00215	lpxB	1.88e-67	5	370	10	383	lipid-A-disaccharide synthase. Lipid-A precursor biosynthesis producing lipid A disaccharide in a condensation reaction. transcribed as part of an operon including lpxA [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
PRK14089	PRK14089	1.15e-52	1	369	2	344	lipid-A-disaccharide synthase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRO51639.1	1.53e-223	1	378	1	378
AZS31618.1	5.92e-221	1	377	1	377
ADY31424.1	1.34e-203	1	378	1	378
SNV26174.1	1.34e-203	1	378	1	378
BAX81022.1	1.13e-144	1	375	1	375

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5W8S_A	3.32e-43	5	356	11	365	LipidA Disaccharide Synthase (LpxB)-7 solubilizing mutations [Escherichia coli BL21(DE3)],5W8X_A Lipid A Disaccharide Synthase (LpxB)-7 solubilizing mutations-Bound to UDP [Escherichia coli BL21(DE3)]
5W8N_A	4.63e-43	5	356	11	365	LipidA Disaccharide Synthase (LpxB)-6 solubilizing mutations [Escherichia coli BL21(DE3)]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
B3E4H8	2.43e-74	2	370	8	377	Lipid-A-disaccharide synthase OS=Trichlorobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ) OX=398767 GN=lpxB PE=3 SV=1
Q39T49	4.34e-72	2	370	8	377	Lipid-A-disaccharide synthase OS=Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15) OX=269799 GN=lpxB PE=3 SV=1
Q2LVL8	2.60e-70	5	375	8	380	Lipid-A-disaccharide synthase OS=Syntrophus aciditrophicus (strain SB) OX=56780 GN=lpxB PE=3 SV=1
Q1D393	2.60e-70	2	370	6	375	Lipid-A-disaccharide synthase OS=Myxococcus xanthus (strain DK1622) OX=246197 GN=lpxB PE=3 SV=1
Q74AT9	2.95e-69	2	370	8	377	Lipid-A-disaccharide synthase OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) OX=243231 GN=lpxB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000051	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001608_00653.