CAZyme Information: MGYG000001608_00800

Basic Information

• Species: Gabonibacter sp900543425
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Marinifilaceae; Gabonibacter; Gabonibacter sp900543425
• CAZyme ID: MGYG000001608_00800
• CAZy Family: GT9
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
352	MGYG000001608_3|CGC4	41428.98	9.1679

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001608	3329116	MAG	China	Asia

• Gene Location: Start: 246397; End: 247455 Strand: -

Full Sequence      

MINKVLIIRFRRIGDAVLSTVICSTIRKNFPEAEIHYLLYDPINTLFEHHPDIDKVISFS
GKDGVGSYLKRVWRLMRKEKYDVIIDTRTTLTSLCFSWFSLKTKYRIGTRKSYSFIGHNY
RIANQKDETLDEVSRNLLLLKPLEQLKPLEYVSDFRLYVTSEESRDFHSFMKQKGIDFSK
PVIICTPFTRVKGKAWHMERMKEVLRLMIETYDAQLIFNYNEQEKEAAFQLFREMKEDKH
LFVHIAADSIRKLAAMCLQADFFFGNEGGPRHIAQALQVHSFAIYPPWVDKTKWLPNPTE
CNQGISSRDLISPDEWKSLTDKERFERITVEEVWARLHPMLDKFLTPKSGII

Enzyme Prediction     

No EC number prediction in MGYG000001608_00800.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT9	71	302	6.6e-31	0.8711111111111111

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG0859	RfaF	1.14e-39	4	337	3	329	ADP-heptose:LPS heptosyltransferase [Cell wall/membrane/envelope biogenesis].
cd03789	GT9_LPS_heptosyltransferase	9.86e-37	4	338	1	276	lipopolysaccharide heptosyltransferase and similar proteins. Lipopolysaccharide heptosyltransferase (2.4.99.B6) is involved in the biosynthesis of lipooligosaccharide (LOS). Lipopolysaccharide (LPS) is a major component of the outer membrane of gram-negative bacteria. LPS heptosyltransferase transfers heptose molecules from ADP-heptose to 3-deoxy-D-manno-octulosonic acid (KDO), a part of the inner core component of LPS. This family also contains lipopolysaccharide 1,2-N-acetylglucosaminetransferase EC 2.4.1.56 and belongs to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.
pfam01075	Glyco_transf_9	6.53e-13	71	301	3	233	Glycosyltransferase family 9 (heptosyltransferase). Members of this family belong to glycosyltransferase family 9. Lipopolysaccharide is a major component of the outer leaflet of the outer membrane in Gram-negative bacteria. It is composed of three domains; lipid A, Core oligosaccharide and the O-antigen. All of these enzymes transfer heptose to the lipopolysaccharide core.
PRK10422	PRK10422	7.75e-08	4	86	7	93	lipopolysaccharide core biosynthesis protein; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AZS29620.1	9.14e-140	2	343	3	346
QRO51368.1	6.48e-139	2	351	3	354
BAR51520.1	4.87e-111	2	345	7	351
BAR48400.1	4.87e-111	2	345	7	351
AEW22458.1	4.87e-111	2	345	7	351

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3TOV_A	1.89e-06	3	287	9	289	Thecrystal structure of the glycosyl transferase family 9 from Veillonella parvula DSM 2008 [Veillonella parvula DSM 2008],3TOV_B The crystal structure of the glycosyl transferase family 9 from Veillonella parvula DSM 2008 [Veillonella parvula DSM 2008]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P25742	1.68e-10	14	341	5	331	Lipopolysaccharide core heptosyltransferase RfaQ OS=Escherichia coli (strain K12) OX=83333 GN=rfaQ PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000090	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001608_00800.