CAZyme Information: MGYG000001609_00350

Basic Information

• Species: Cloacibacillus porcorum
• Lineage: Bacteria; Synergistota; Synergistia; Synergistales; Synergistaceae; Cloacibacillus; Cloacibacillus porcorum
• CAZyme ID: MGYG000001609_00350
• CAZy Family: GH23
• CAZyme Description: Membrane-bound lytic murein transglycosylase C

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
339	MGYG000001609_2|CGC1	37692.16	10.0697

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001609	3330624	MAG	China	Asia

• Gene Location: Start: 89070; End: 90089 Strand: -

Full Sequence      

MHAIPSGVKIIFNKITQRFSDCKQKNGGAGKFMLRVTVLCALLASLPLISGAVHREAASD
WREGWREWKSGDAAAALNSWSKNPLTSPFEIRPARVAYWKIRALERLGRDEEAAVAASLL
ALRHPLDFYSLVLAYEGRYPALTRLVRSACARAAYIRRWNGEVAVASAKTGVSQNILLGL
IRQESKFNEQAVSRSGAVGLMQLMPFTAREAAARLKNEELSPYDPTHNIMLGAAYFAHLK
ARFSNKLPLALAAYNAGAASVSRWDTEAGDWVEWIEEIPYPQTREYVRSVLENIEIYNVT
DQEKRNGEPSFFAEALNRPQLMKKVASGKRPEGVGTNAR

Enzyme Prediction     

No EC number prediction in MGYG000001609_00350.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	173	299	2.3e-28	0.8222222222222222

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd13401	Slt70-like	1.03e-49	154	298	1	150	70kDa soluble lytic transglycosylase (Slt70) and similar proteins. Catalytic domain of the 70kda soluble lytic transglycosylase (LT)-like proteins, which also have an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
cd16896	LT_Slt70-like	4.69e-32	166	296	11	146	uncharacterized lytic transglycosylase subfamily with similarity to Slt70. Uncharacterized lytic transglycosylase (LT) with a conserved sequence pattern suggesting similarity to the Slt70, a 70kda soluble lytic transglycosylase which also has an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd00254	LT-like	4.40e-25	177	295	4	111	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
pfam01464	SLT	7.54e-25	166	249	4	87	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.
cd16893	LT_MltC_MltE	2.94e-20	163	243	3	89	membrane-bound lytic murein transglycosylases MltC and MltE, and similar proteins. MltC and MltE are periplasmic, outer membrane attached lytic transglycosylases (LTs), which cleave beta-1,4-glycosidic bonds joining N-acetylmuramic acid and N-acetylglucosamine in the cell wall peptidoglycan, yielding 1,6-anhydromuropeptides. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ANZ45896.1	9.24e-246	1	339	1	339
AFM21693.1	2.59e-32	61	304	345	653
ADE56509.1	1.96e-28	61	299	351	653
ASI47963.1	2.30e-27	174	298	520	655
AOR76690.1	4.20e-27	171	333	500	663

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5MPQ_A	3.07e-20	69	297	337	555	BulgecinA: The key to a broad-spectrum inhibitor that targets lytic transglycosylases [Neisseria meningitidis]
5O1J_A	3.09e-20	69	297	341	559	Lytictransglycosylase in action [Neisseria meningitidis MC58]
6FPN_B	3.12e-20	69	297	347	565	Lytictransglycosylase in action [Neisseria meningitidis MC58]
5O24_A	3.14e-20	69	297	351	569	Lytictransglycosylase in action [Neisseria meningitidis]
5O29_A	3.17e-20	69	297	357	575	Lytictransglycosylase in action [Neisseria meningitidis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P44888	2.99e-15	172	318	441	591	Putative soluble lytic murein transglycosylase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=slt PE=3 SV=1
O31608	5.21e-15	160	290	61	175	Putative murein lytic transglycosylase YjbJ OS=Bacillus subtilis (strain 168) OX=224308 GN=yjbJ PE=3 SV=1
O64046	1.96e-13	155	293	1418	1540	Probable tape measure protein OS=Bacillus phage SPbeta OX=66797 GN=yomI PE=3 SV=1
O31976	1.96e-13	155	293	1418	1540	SPbeta prophage-derived uncharacterized transglycosylase YomI OS=Bacillus subtilis (strain 168) OX=224308 GN=yomI PE=3 SV=2
P39434	4.54e-13	172	291	493	619	Soluble lytic murein transglycosylase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=slt PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.728483	0.244070	0.025740	0.000427	0.000357	0.000924

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001609_00350.