CAZyme Information: MGYG000001609_00694

Basic Information

• Species: Cloacibacillus porcorum
• Lineage: Bacteria; Synergistota; Synergistia; Synergistales; Synergistaceae; Cloacibacillus; Cloacibacillus porcorum
• CAZyme ID: MGYG000001609_00694
• CAZy Family: CBM48
• CAZyme Description: 1,4-alpha-glucan branching enzyme GlgB

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
649		73240.89	4.8498

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001609	3330624	MAG	China	Asia

• Gene Location: Start: 113856; End: 115805 Strand: -

Full Sequence      

MLEAMNMQNEIIYGPTLAGEGDVYLFREGTHRRIYDFLGAHPFEHEGRKGVLFSLWAPGA
KNVYVMGDFNSWEREGCPLAPRWDSSGIWEGFVPDAEAGCRYKYVIRTAGGELVDKSDPL
AFAAETPPASASVVCAPAHEWRDAAWMAARAEKNATDAPQSIYEMHAGSWRRGDGDSILS
WRDLAGELPPYLEANGFTHVEFMPVMEHPFYGSWGYQTTGYFAPTARYGSPEDFMALVDA
LHARGIGVILDWVPSHFPTDSFGLSRFDGTALYEHEDPRQGFHPDWKSAIFNYGRNEVRS
FLISSAYYWLDRYHADGLRVDAVASMLYLDYSRRDGEWVANKYGGKENIEAIAFLREMNC
ALYADFPGISVTAEESTSWPMVTKPVWLGGLGFGYKWNMGWMNDFISYMSQDPVYRKYRH
DQLTFGMWYAYAENFVLPFSHDEVVHGKCSLLEKMPGDGWQKAANLRLMFGWMFCHPGKK
LVFMGGEFGQSREWNHDRSLDWHELGDERHAGIARWFADLNNFYRGRPELWELDTSPDGF
EWIDCSDRDAGVVSFIRRDKRGGALVFAANFTPVVRGGYRIGFPKGGRWREALNSDSSLY
GGSGAGNLGFVDTEESSFHGQPFSAELTLPPLGCLIFAPENGADEGTED

Enzyme Prediction     

EC	2.4.1.18

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH13	190	490	8.2e-158	0.9966777408637874
CBM48	38	124	2.1e-16	0.8947368421052632

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK12313	PRK12313	0.0	22	640	11	628	1,4-alpha-glucan branching protein GlgB.
PRK14706	PRK14706	0.0	37	639	26	621	glycogen branching enzyme; Provisional
PRK14705	PRK14705	0.0	13	639	599	1222	glycogen branching enzyme; Provisional
COG0296	GlgB	0.0	15	639	3	628	1,4-alpha-glucan branching enzyme [Carbohydrate transport and metabolism].
PRK05402	PRK05402	0.0	13	640	96	724	1,4-alpha-glucan branching protein GlgB.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ANZ46564.1	0.0	7	649	1	643
QJT09347.1	2.33e-302	7	637	1	634
ALC15342.1	9.06e-298	8	640	3	639
QID34105.1	7.96e-294	11	636	3	624
ACI20861.1	6.83e-292	13	636	4	629

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6JOY_A	3.25e-251	20	642	6	621	TheX-ray Crystallographic Structure of Branching Enzyme from Rhodothermus obamensis STB05 [Rhodothermus marinus]
1M7X_A	4.64e-245	25	640	1	615	TheX-ray Crystallographic Structure of Branching Enzyme [Escherichia coli],1M7X_B The X-ray Crystallographic Structure of Branching Enzyme [Escherichia coli],1M7X_C The X-ray Crystallographic Structure of Branching Enzyme [Escherichia coli],1M7X_D The X-ray Crystallographic Structure of Branching Enzyme [Escherichia coli]
4LPC_A	2.57e-243	30	640	1	610	CrystalStructure of E.Coli Branching Enzyme in complex with maltoheptaose [Escherichia coli],4LPC_B Crystal Structure of E.Coli Branching Enzyme in complex with maltoheptaose [Escherichia coli],4LPC_C Crystal Structure of E.Coli Branching Enzyme in complex with maltoheptaose [Escherichia coli],4LPC_D Crystal Structure of E.Coli Branching Enzyme in complex with maltoheptaose [Escherichia coli],4LQ1_A Crystal Structure of E.Coli Branching Enzyme in complex with maltohexaose [Escherichia coli],4LQ1_B Crystal Structure of E.Coli Branching Enzyme in complex with maltohexaose [Escherichia coli],4LQ1_C Crystal Structure of E.Coli Branching Enzyme in complex with maltohexaose [Escherichia coli],4LQ1_D Crystal Structure of E.Coli Branching Enzyme in complex with maltohexaose [Escherichia coli],5E6Y_A Crystal structure of E.Coli branching enzyme in complex with alpha cyclodextrin [Escherichia coli O139:H28 str. E24377A],5E6Y_B Crystal structure of E.Coli branching enzyme in complex with alpha cyclodextrin [Escherichia coli O139:H28 str. E24377A],5E6Y_C Crystal structure of E.Coli branching enzyme in complex with alpha cyclodextrin [Escherichia coli O139:H28 str. E24377A],5E6Y_D Crystal structure of E.Coli branching enzyme in complex with alpha cyclodextrin [Escherichia coli O139:H28 str. E24377A],5E6Z_A Crystal structure of Ecoli Branching Enzyme with beta cyclodextrin [Escherichia coli O139:H28 str. E24377A],5E6Z_B Crystal structure of Ecoli Branching Enzyme with beta cyclodextrin [Escherichia coli O139:H28 str. E24377A],5E6Z_C Crystal structure of Ecoli Branching Enzyme with beta cyclodextrin [Escherichia coli O139:H28 str. E24377A],5E6Z_D Crystal structure of Ecoli Branching Enzyme with beta cyclodextrin [Escherichia coli O139:H28 str. E24377A],5E70_A Crystal structure of Ecoli Branching Enzyme with gamma cyclodextrin [Escherichia coli O139:H28 str. E24377A],5E70_B Crystal structure of Ecoli Branching Enzyme with gamma cyclodextrin [Escherichia coli O139:H28 str. E24377A],5E70_C Crystal structure of Ecoli Branching Enzyme with gamma cyclodextrin [Escherichia coli O139:H28 str. E24377A],5E70_D Crystal structure of Ecoli Branching Enzyme with gamma cyclodextrin [Escherichia coli O139:H28 str. E24377A]
3K1D_A	3.32e-241	15	639	99	721	Crystalstructure of glycogen branching enzyme synonym: 1,4-alpha-D-glucan:1,4-alpha-D-GLUCAN 6-glucosyl-transferase from mycobacterium tuberculosis H37RV [Mycobacterium tuberculosis H37Rv]
5GQW_A	8.78e-236	15	636	127	770	Crystalstructure of branching enzyme W610N mutant from Cyanothece sp. ATCC 51142 [Crocosphaera subtropica ATCC 51142],5GQX_A Crystal structure of branching enzyme W610N mutant from Cyanothece sp. ATCC 51142 in complex with maltoheptaose [Crocosphaera subtropica ATCC 51142]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O66936	2.02e-283	16	640	5	629	1,4-alpha-glucan branching enzyme GlgB OS=Aquifex aeolicus (strain VF5) OX=224324 GN=glgB PE=3 SV=1
Q5NXV7	1.02e-282	20	640	12	628	1,4-alpha-glucan branching enzyme GlgB OS=Aromatoleum aromaticum (strain EbN1) OX=76114 GN=glgB PE=3 SV=1
Q21WG7	4.95e-278	17	637	1	619	1,4-alpha-glucan branching enzyme GlgB OS=Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118) OX=338969 GN=glgB PE=3 SV=1
Q1AZ86	1.20e-268	15	639	96	719	1,4-alpha-glucan branching enzyme GlgB OS=Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129 / PRD-1) OX=266117 GN=glgB PE=3 SV=1
A3PIQ5	1.39e-266	15	639	107	727	1,4-alpha-glucan branching enzyme GlgB OS=Cereibacter sphaeroides (strain ATCC 17029 / ATH 2.4.9) OX=349101 GN=glgB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000050	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001609_00694.