CAZyme Information: MGYG000001609_00941

Basic Information

• Species: Cloacibacillus porcorum
• Lineage: Bacteria; Synergistota; Synergistia; Synergistales; Synergistaceae; Cloacibacillus; Cloacibacillus porcorum
• CAZyme ID: MGYG000001609_00941
• CAZy Family: GT51
• CAZyme Description: Penicillin-binding protein 1C

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
770	MGYG000001609_7|CGC1	82386.02	9.9358

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001609	3330624	MAG	China	Asia

• Gene Location: Start: 51404; End: 53716 Strand: +

Full Sequence      

MLLNRNFPAAVSDALAAARRRFSERGLPHRAALVVLVFLLLAKAALVVTFPLGAILNRPA
SLVVTDREGRPLRGTLSAAGEWRLPVPLADMGRWMPAAAVALEDRRFYLHGGIDTIAIAR
AAWQNFTGGRVVSGASTITSQVVRLAVDRPRTPWAKAVEFSQGAALEFFMDKDEILESYL
NSVPFGGNTRGVEAAARSWFGKPAKELSLAEAALLAGLLRGPAYYRPDRHPERALALRNR
LIDTLENRGVATPQEARRAKAEPLPAGRRAISSARIQAAEAAARYGGAAVARDGYGRFRS
TLDSAMQRLLTGELTAALGNMEPGVTAAAVLVENETGKVRGYVGNAREGTGSGASWVDCA
LSPRSPGSTLKPFVYALAFESGRAIPATMLADTPQQPSGGGTRNFDRLFRGPVSARTALA
DSLNVPAVRILRAAGAENVLGLFRRLGFSQLTREAEWYGDSLALGGCEVSPLELARAYRT
LAAGGLDSPLVWNERAGLSAGTRVISAEAAALTLDILKDTRRNLPLYGEAGADGKTVAFK
TGTSYGLRDAWTAAVTRKWTLVVWFGDPGGRPHRGLVGLKTAAPSAVRIMLKLTKKGDPW
FTLPPSVVRKELCALSGAPRNQWCPQSRRGLFIEGVSDAAPCSLHTMKEGEISIKWPPEL
EGFFTGRGNREAEQPLTITSPKDGAVYAVGAENNKLILSSKGGRGPVYWFVDGELAGDSG
EGAPLAWKMREGVHKIAAADEYGAADEIEIIVRNQAEDGTEELPLLEESR

Enzyme Prediction     

No EC number prediction in MGYG000001609_00941.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT51	80	244	2.6e-51	0.9322033898305084

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
TIGR02073	PBP_1c	6.29e-176	58	752	8	726	penicillin-binding protein 1C. This subfamily of the penicillin binding proteins includes the member from E. coli designated penicillin-binding protein 1C. Members have both transglycosylase and transpeptidase domains and are involved in forming cross-links in the late stages of peptidoglycan biosynthesis. All members of this subfamily are presumed to have the same basic function. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
COG4953	PbpC	1.22e-170	45	754	20	733	Membrane carboxypeptidase/penicillin-binding protein PbpC [Cell wall/membrane/envelope biogenesis].
COG0744	MrcB	1.23e-112	55	630	49	636	Membrane carboxypeptidase (penicillin-binding protein) [Cell wall/membrane/envelope biogenesis].
TIGR02074	PBP_1a_fam	7.07e-112	83	596	2	531	penicillin-binding protein, 1A family. Bacterial that synthesize a cell wall of peptidoglycan (murein) generally have several transglycosylases and transpeptidases for the task. This family consists of bifunctional transglycosylase/transpeptidase penicillin-binding proteins (PBP). In the Proteobacteria, this family includes PBP 1A but not the paralogous PBP 1B (TIGR02071). This family also includes related proteins, often designated PBP 1A, from other bacterial lineages. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
PRK11240	PRK11240	1.16e-93	63	752	42	771	penicillin-binding protein 1C; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ANZ46172.1	0.0	1	770	1	770
QTX32363.1	2.11e-189	60	752	35	711
QVL36238.1	6.71e-188	60	752	35	711
ADE56317.1	3.69e-180	59	767	43	734
CRH05035.1	3.79e-118	53	750	40	780

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5FGZ_A	3.30e-41	77	605	150	703	E.coli PBP1b in complex with FPI-1465 [Escherichia coli K-12],5HL9_A E. coli PBP1b in complex with acyl-ampicillin and moenomycin [Escherichia coli K-12],5HLA_A E. coli PBP1b in complex with acyl-cephalexin and moenomycin [Escherichia coli K-12],5HLB_A E. coli PBP1b in complex with acyl-aztreonam and moenomycin [Escherichia coli K-12],5HLD_A E. coli PBP1b in complex with acyl-CENTA and moenomycin [Escherichia coli K-12],6YN0_A Structure of E. coli PBP1b with a FtsN peptide activating transglycosylase activity [Escherichia coli K-12],7LQ6_A Chain A, Penicillin-binding protein 1B [Escherichia coli K-12]
3VMA_A	3.75e-41	77	605	171	724	CrystalStructure of the Full-Length Transglycosylase PBP1b from Escherichia coli [Escherichia coli K-12]
3FWL_A	6.39e-39	77	605	154	707	CrystalStructure of the Full-Length Transglycosylase PBP1b from Escherichia coli [Escherichia coli]
2OQO_A	3.27e-34	66	255	6	193	Crystalstructure of a peptidoglycan glycosyltransferase from a class A PBP: insight into bacterial cell wall synthesis [Aquifex aeolicus VF5],3D3H_A Crystal structure of a complex of the peptidoglycan glycosyltransferase domain from Aquifex aeolicus and neryl moenomycin A [Aquifex aeolicus],3NB7_A Crystal structure of Aquifex Aeolicus Peptidoglycan Glycosyltransferase in complex with Decarboxylated Neryl Moenomycin [Aquifex aeolicus]
3NB6_A	1.13e-33	66	255	6	193	Crystalstructure of Aquifex aeolicus peptidoglycan glycosyltransferase in complex with Methylphosphoryl Neryl Moenomycin [Aquifex aeolicus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P76577	2.36e-92	59	753	41	770	Penicillin-binding protein 1C OS=Escherichia coli (strain K12) OX=83333 GN=pbpC PE=1 SV=1
Q9KUC0	3.76e-46	98	599	195	716	Penicillin-binding protein 1B OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) OX=243277 GN=mrcB PE=3 SV=1
P38050	2.38e-45	60	612	47	613	Penicillin-binding protein 1F OS=Bacillus subtilis (strain 168) OX=224308 GN=pbpF PE=2 SV=2
P45345	5.15e-41	76	589	161	696	Penicillin-binding protein 1B OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=mrcB PE=3 SV=1
O66874	8.69e-41	59	643	42	717	Penicillin-binding protein 1A OS=Aquifex aeolicus (strain VF5) OX=224324 GN=mrcA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999898	0.000124	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
31	53