CAZyme Information: MGYG000001609_02677

Basic Information

• Species: Cloacibacillus porcorum
• Lineage: Bacteria; Synergistota; Synergistia; Synergistales; Synergistaceae; Cloacibacillus; Cloacibacillus porcorum
• CAZyme ID: MGYG000001609_02677
• CAZy Family: GT19
• CAZyme Description: Lipid-A-disaccharide synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
377	MGYG000001609_36|CGC1	41858.33	7.1737

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001609	3330624	MAG	China	Asia

• Gene Location: Start: 27555; End: 28688 Strand: -

Full Sequence      

MSIFISSGEASGDHYTANLAKRLRAGGYSGDIWGMGGVESREAGIRVEWPGERLQLFGLM
EVLSAIPSIIALRGEMVRRILETAPEAVIVCDSPDYHMHLISKLRSRGYRGRIFYISPPS
VWAWRSGRAEDLRRNVDECLPLFKFEHEYLLSRGCASHWRGHPLVEEFGRLAAEPSKLAG
RFDHERLVAFLPGSRRSEVTALLPMMREVAGILAAKGWQPVFSVAPGLNPAVRGDMIEEF
TRDGILFYDGPGHDLMAAARCAVGASGTITVESLLLGCYMVVTYKLNPISALVGRCVVKT
PYYAMANILAGEEMFPELMQEKATVKNILAHTLAWLEDGGDFRENTKKTMKRTLLTLGEE
GVYDFWSRRIMEAAANA

Enzyme Prediction     

No EC number prediction in MGYG000001609_02677.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT19	3	352	1.3e-88	0.9774011299435028

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG0763	LpxB	6.83e-88	1	344	2	350	Lipid A disaccharide synthetase [Cell wall/membrane/envelope biogenesis].
PRK00025	lpxB	2.78e-84	1	339	2	342	lipid-A-disaccharide synthase; Reviewed
pfam02684	LpxB	1.02e-79	3	363	1	364	Lipid-A-disaccharide synthetase. This is a family of lipid-A-disaccharide synthetases, EC:2.4.2.128. These enzymes catalyze the reaction: UDP-2,3-bis(3-hydroxytetradecanoyl) glucosamine + 2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate <=> UDP + 2,3-bis(3-hydroxytetradecanoyl)-D-glucosaminyl-1,6 -beta-D-2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate. These enzymes catalyze the fist disaccharide step in the synthesis of lipid-A-disaccharide.
TIGR00215	lpxB	1.25e-52	2	352	7	357	lipid-A-disaccharide synthase. Lipid-A precursor biosynthesis producing lipid A disaccharide in a condensation reaction. transcribed as part of an operon including lpxA [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
PRK01021	lpxB	1.66e-44	2	330	228	570	lipid-A-disaccharide synthase; Reviewed

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ANZ45970.1	7.43e-278	1	377	1	377
AER66289.1	1.57e-102	1	372	1	368
QVL35430.1	2.23e-91	1	372	1	368
QTX31623.1	2.23e-91	1	372	1	368
AFM20975.1	5.60e-85	1	367	1	358

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5W8S_A	2.48e-35	1	339	7	348	LipidA Disaccharide Synthase (LpxB)-7 solubilizing mutations [Escherichia coli BL21(DE3)],5W8X_A Lipid A Disaccharide Synthase (LpxB)-7 solubilizing mutations-Bound to UDP [Escherichia coli BL21(DE3)]
5W8N_A	4.78e-35	1	339	7	348	LipidA Disaccharide Synthase (LpxB)-6 solubilizing mutations [Escherichia coli BL21(DE3)]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
C1DST3	1.83e-57	1	344	5	352	Lipid-A-disaccharide synthase OS=Azotobacter vinelandii (strain DJ / ATCC BAA-1303) OX=322710 GN=lpxB PE=3 SV=1
Q02AZ6	1.47e-51	3	344	4	343	Lipid-A-disaccharide synthase OS=Solibacter usitatus (strain Ellin6076) OX=234267 GN=lpxB PE=3 SV=1
Q6ALW0	6.40e-51	3	328	12	342	Lipid-A-disaccharide synthase OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) OX=177439 GN=lpxB PE=3 SV=1
Q5FUA3	1.31e-49	3	336	31	365	Lipid-A-disaccharide synthase OS=Gluconobacter oxydans (strain 621H) OX=290633 GN=lpxB PE=3 SV=1
Q0VQE4	6.71e-49	3	337	10	346	Lipid-A-disaccharide synthase OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) OX=393595 GN=lpxB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.997872	0.002047	0.000050	0.000009	0.000006	0.000013

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001609_02677.