CAZyme Information: MGYG000001611_00756

Basic Information

• Species: Phocea massiliensis
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Ruminococcaceae; Phocea; Phocea massiliensis
• CAZyme ID: MGYG000001611_00756
• CAZy Family: GH5
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
378		43100.99	4.28

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001611	2083724	MAG	China	Asia

• Gene Location: Start: 57518; End: 58654 Strand: -

Full Sequence      

MKKLHYLCFLMLISLVFTACTATGNNSVPSLPQSSQETPAEDSSAQSAQEPSEQPVDHKE
EQSKTESQADAPEEPVSMNGEYPISPADYQKLLGKGMDVDWSKTNQGRKYYNTQAAIDFS
EAGISHVRIRIADKATDDLLEGLDRQIEDCLANGIIPVIAYQADEFKNDPSEENIQEVVD
WWTKVARRYQDTSYLLSFDLLIESTDALNKQPDKLNEIYEQLVTEIRKTNPNRIIMISPR
LRSDAAYLHELEIPTDHNDYLMAEWHFYAAGPSKTNDRKLWTTGTEQERSLIDEKIQLAL
EWQQETGIPTWVGAWMPGNYNDGNDYTIEEQVVFSSYMTQQLTNAGIPFAVNSDTKFYDR
KSNKWIPTMMPVFDCIYS

Enzyme Prediction     

No EC number prediction in MGYG000001611_00756.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	123	351	6e-26	0.9122137404580153

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00150	Cellulase	7.63e-15	107	340	20	258	Cellulase (glycosyl hydrolase family 5).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIB28168.1	1.16e-159	83	378	4	299
QUF84801.1	1.42e-144	83	372	28	317
QMW91197.1	2.01e-144	83	372	28	317
BBK76626.1	2.01e-144	83	372	28	317
AXB85103.1	8.10e-144	83	372	28	317

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4U5I_A	1.81e-14	84	322	76	322	ChainA, Endoglucanase H [Acetivibrio thermocellus ATCC 27405],4U5I_B Chain B, Endoglucanase H [Acetivibrio thermocellus ATCC 27405],4U5K_A Chain A, Endoglucanase H [Acetivibrio thermocellus ATCC 27405],4U5K_B Chain B, Endoglucanase H [Acetivibrio thermocellus ATCC 27405]
3AZR_A	6.14e-14	84	342	3	276	DiverseSubstrates Recognition Mechanism Revealed by Thermotoga maritima Cel5A Structures in Complex with Cellobiose [Thermotoga maritima MSB8],3AZR_B Diverse Substrates Recognition Mechanism Revealed by Thermotoga maritima Cel5A Structures in Complex with Cellobiose [Thermotoga maritima MSB8],3AZS_A Diverse Substrates Recognition Mechanism Revealed by Thermotoga maritima Cel5A Structures in Complex with Mannotriose [Thermotoga maritima MSB8],3AZS_B Diverse Substrates Recognition Mechanism Revealed by Thermotoga maritima Cel5A Structures in Complex with Mannotriose [Thermotoga maritima MSB8],3AZT_A Diverse Substrates Recognition Mechanism Revealed by Thermotoga maritima Cel5A Structures in Complex with Cellotetraose [Thermotoga maritima MSB8],3AZT_B Diverse Substrates Recognition Mechanism Revealed by Thermotoga maritima Cel5A Structures in Complex with Cellotetraose [Thermotoga maritima MSB8],3AZT_C Diverse Substrates Recognition Mechanism Revealed by Thermotoga maritima Cel5A Structures in Complex with Cellotetraose [Thermotoga maritima MSB8],3AZT_D Diverse Substrates Recognition Mechanism Revealed by Thermotoga maritima Cel5A Structures in Complex with Cellotetraose [Thermotoga maritima MSB8]
4U3A_A	7.85e-14	84	322	76	322	ChainA, Endoglucanase H [Acetivibrio thermocellus ATCC 27405],4U3A_B Chain B, Endoglucanase H [Acetivibrio thermocellus ATCC 27405]
3AMC_A	2.73e-13	84	342	3	276	Crystalstructures of Thermotoga maritima Cel5A, apo form and dimer/au [Thermotoga maritima MSB8],3AMC_B Crystal structures of Thermotoga maritima Cel5A, apo form and dimer/au [Thermotoga maritima MSB8],3AMD_A Crystal structures of Thermotoga maritima Cel5A, apo form and tetramer/au [Thermotoga maritima MSB8],3AMD_B Crystal structures of Thermotoga maritima Cel5A, apo form and tetramer/au [Thermotoga maritima MSB8],3AMD_C Crystal structures of Thermotoga maritima Cel5A, apo form and tetramer/au [Thermotoga maritima MSB8],3AMD_D Crystal structures of Thermotoga maritima Cel5A, apo form and tetramer/au [Thermotoga maritima MSB8],3MMU_A Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMU_B Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMU_C Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMU_D Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMU_E Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMU_F Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMU_G Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMU_H Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMW_A Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMW_B Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMW_C Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMW_D Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima]
3RJY_A	2.80e-13	84	366	11	310	CrystalStructure of Hyperthermophilic Endo-beta-1,4-glucanase in complex with substrate [Fervidobacterium nodosum Rt17-B1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P25472	1.32e-18	75	365	19	319	Endoglucanase D OS=Ruminiclostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10) OX=394503 GN=celCCD PE=3 SV=1
P16218	8.04e-13	84	322	327	573	Endoglucanase H OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=celH PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000000	1.000064	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001611_00756.