CAZyme Information: MGYG000001611_01004

Basic Information

• Species: Phocea massiliensis
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Ruminococcaceae; Phocea; Phocea massiliensis
• CAZyme ID: MGYG000001611_01004
• CAZy Family: CBM50
• CAZyme Description: Mannosylglucosyl-3-phosphoglycerate phosphatase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
555	MGYG000001611_7|CGC1	59277.81	4.5823

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001611	2083724	MAG	China	Asia

• Gene Location: Start: 26238; End: 27905 Strand: +

Full Sequence      

MRRILSMVLAAALALSMLSTAAFAQTGETTTIKVFHTNDSHSRAKEVVDSKTGELTNIGF
ARFKTFIDSQEADGKLILDAGDTFHGMPFATIENGNSIAKILKAVGYDAISPGNHDFNYG
YERLDVLSYRAGVKPLAANVTIGGKNAFDKYLIKNIDGVKVGVFGLATPETAYKTNPKNV
AGLDFGDKESLIATAQQMVDELQERDCDVIIALCHLGVDPTSDIKSTDIANAVEGIDLII
DGHSHTELDNYKVGDTYIASTGNYLENVGMVTIKVKDGEVLSVEPKLYSAKELKNFPEDS
KVKAIVDRIDENQKSILDVVIGKTPITLDGERETNRGGHTNLGRLITSAMLEETGADIAL
TNGGGIRATIEKGDITKGDVINVLPFGNYIVTKQVKGQDIIDALNFGMDFGAGGFPHFAG
MTVEAKKVETTAEDGTTKTKGQVLSILVDGKPIDPNATYTLATNDFMASGGDGYTMLGNY
PIENEFSALDEALIRYLSKVGDEGIKAIDAEERLILTDVAKNPALGSGTAATAPSTPFVP
DDSDKNNPSTGRWAA

Enzyme Prediction     

No EC number prediction in MGYG000001611_01004.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG0737	UshA	1.61e-98	21	504	16	502	2',3'-cyclic-nucleotide 2'-phosphodiesterase/5'- or 3'-nucleotidase, 5'-nucleotidase family [Nucleotide transport and metabolism, Defense mechanisms].
PRK09558	ushA	7.20e-98	20	509	23	541	bifunctional UDP-sugar hydrolase/5'-nucleotidase periplasmic precursor; Reviewed
PRK09419	PRK09419	1.79e-95	30	534	659	1163	multifunctional 2',3'-cyclic-nucleotide 2'-phosphodiesterase/3'-nucleotidase/5'-nucleotidase.
cd07408	MPP_SA0022_N	4.95e-66	32	289	1	255	Staphylococcus aureus SA0022 and related proteins, N-terminal metallophosphatase domain. SA0022 is an uncharacterized Staphylococcus aureus UshA-like protein with two putative domains, an N-terminal metallophosphatase domain and a C-terminal nucleotidase domain. SA0022 also contains a putative C-terminal cell wall anchor domain. The N-terminal metallophosphatase domain belongs to a large superfamily of distantly related metallophosphatases (MPPs) that includes: Mre11/SbcD-like exonucleases, Dbr1-like RNA lariat debranching enzymes, YfcE-like phosphodiesterases, purple acid phosphatases (PAPs), YbbF-like UDP-2,3-diacylglucosamine hydrolases, and acid sphingomyelinases (ASMases). MPPs are functionally diverse, but all share a conserved domain with an active site consisting of two metal ions (usually manganese, iron, or zinc) coordinated with octahedral geometry by a cage of histidine, aspartate, and asparagine residues. The conserved domain is a double beta-sheet sandwich with a di-metal active site made up of residues located at the C-terminal side of the sheets. This domain is thought to allow for productive metal coordination.
cd00845	MPP_UshA_N_like	9.96e-54	32	279	1	242	Escherichia coli UshA-like family, N-terminal metallophosphatase domain. This family includes the bacterial enzyme UshA, and related enzymes including SoxB, CpdB, YhcR, and CD73. All members have a similar domain architecture which includes an N-terminal metallophosphatase domain and a C-terminal nucleotidase domain. The N-terminal metallophosphatase domain belongs to a large superfamily of distantly related metallophosphatases (MPPs) that includes: Mre11/SbcD-like exonucleases, Dbr1-like RNA lariat debranching enzymes, YfcE-like phosphodiesterases, purple acid phosphatases (PAPs), YbbF-like UDP-2,3-diacylglucosamine hydrolases, and acid sphingomyelinases (ASMases). MPPs are functionally diverse, but all share a conserved domain with an active site consisting of two metal ions (usually manganese, iron, or zinc) coordinated with octahedral geometry by a cage of histidine, aspartate, and asparagine residues. The conserved domain is a double beta-sheet sandwich with a di-metal active site made up of residues located at the C-terminal side of the sheets. This domain is thought to allow for productive metal coordination.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QQY79959.1	9.01e-155	2	502	6	499
QZY54554.1	7.46e-142	32	521	34	512
AST94697.1	1.47e-138	28	502	26	489
QNM45137.1	1.47e-138	28	502	26	489
ALA51847.1	5.69e-138	28	502	25	488

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2Z1A_A	5.31e-52	22	506	22	525	Crystalstructure of 5'-nucleotidase precursor from Thermus thermophilus HB8 [Thermus thermophilus HB8]
1HP1_A	7.13e-51	32	499	9	498	5'-Nucleotidase(Open Form) Complex With Atp [Escherichia coli]
1HO5_A	1.16e-50	32	499	9	507	5'-Nucleotidase(E. Coli) In Complex With Adenosine And Phosphate [Escherichia coli],1HO5_B 5'-Nucleotidase (E. Coli) In Complex With Adenosine And Phosphate [Escherichia coli],1HPU_A 5'-Nucleotidase (Closed Form), Complex With Ampcp [Escherichia coli],1HPU_B 5'-Nucleotidase (Closed Form), Complex With Ampcp [Escherichia coli],1HPU_C 5'-Nucleotidase (Closed Form), Complex With Ampcp [Escherichia coli],1HPU_D 5'-Nucleotidase (Closed Form), Complex With Ampcp [Escherichia coli]
1USH_A	1.81e-50	32	499	34	532	5'-NucleotidaseFrom E. Coli [Escherichia coli K-12],2USH_A 5'-Nucleotidase From E. Coli [Escherichia coli K-12],2USH_B 5'-Nucleotidase From E. Coli [Escherichia coli K-12]
4WWL_A	2.57e-50	32	481	9	488	E.coli 5'-nucleotidase mutant I521C labeled with MTSL (intermediate form) [Escherichia coli K-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A9BJC1	2.38e-74	34	521	26	503	Mannosylglucosyl-3-phosphoglycerate phosphatase OS=Petrotoga mobilis (strain DSM 10674 / SJ95) OX=403833 GN=mggB PE=1 SV=1
O34313	1.34e-58	32	503	669	1165	Trifunctional nucleotide phosphoesterase protein YfkN OS=Bacillus subtilis (strain 168) OX=224308 GN=yfkN PE=1 SV=1
Q9KQ30	2.29e-54	32	481	38	516	5'-nucleotidase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) OX=243277 GN=nutA PE=3 SV=1
P22848	8.84e-51	32	481	38	516	5'-nucleotidase OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) OX=223926 GN=nutA PE=3 SV=2
P07024	9.92e-50	32	499	34	532	Protein UshA OS=Escherichia coli (strain K12) OX=83333 GN=ushA PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000264	0.999033	0.000166	0.000186	0.000168	0.000152

TMHMM  Annotations     

start	end
5	27