CAZyme Information: MGYG000001613_01007

Basic Information

• Species: Allisonella pneumosintes
• Lineage: Bacteria; Firmicutes_C; Negativicutes; Veillonellales; Dialisteraceae; Allisonella; Allisonella pneumosintes
• CAZyme ID: MGYG000001613_01007
• CAZy Family: GT83
• CAZyme Description: Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
530	MGYG000001613_5|CGC2	59942.17	9.6619

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001613	1269637	MAG	China	Asia

• Gene Location: Start: 60286; End: 61878 Strand: -

Full Sequence      

MTTSQKRTCLLLLLLGMVLYGLYLGFIPLLDPDEPVYGQTAKEMLITGDWLSPRIYGEFW
YDKPPLFYWLEAISFSCFGISTWSARLPSVIGAIITSIYLFLSACPLIGEKAARRGAFIF
ATSLEIIILARSAVTDTTLLLALTVAMMSFARKKYISAYTACGVALLAKGPIGFGFPALI
VGLWLLLTKQLNLTNIMKLRWIWGIPLACLIGLPWFIYMSIYHGSTFTDTFLGYHNITRF
ITPEHEGQNHIWMYFLVLTAGFFPWTGTIPLIFSYVKHWKQNKVLMYFIVWASFIFVFFS
LSSTQLFSYILPMYPPLALLSGYAITKLEEKSKVSIYIPTMHFIFILVVAIALALSPILP
IGGILTKLLIFISLFILGGISAYTMKKKLFSYFFLTQGIISLFVILSVWILFATSISENF
ASKNIGDKLSATPYISTNTLYIDSFYRPGIAFYQNIYGKPLPNANAAITVSPHNTQNIYL
PSSSKEITIPQNSYFLVQKKTYNKYPESEKKNFSILWELDTAYFLIKKGV

Enzyme Prediction     

No EC number prediction in MGYG000001613_01007.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT83	3	410	3.9e-103	0.7870370370370371

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1807	ArnT	1.03e-41	24	426	25	414	4-amino-4-deoxy-L-arabinose transferase or related glycosyltransferase of PMT family [Cell wall/membrane/envelope biogenesis].
PRK13279	arnT	2.04e-23	24	413	23	399	lipid IV(A) 4-amino-4-deoxy-L-arabinosyltransferase.
pfam13231	PMT_2	1.91e-09	62	211	1	152	Dolichyl-phosphate-mannose-protein mannosyltransferase. This family contains members that are not captured by pfam02366.
pfam02366	PMT	2.90e-06	24	218	15	233	Dolichyl-phosphate-mannose-protein mannosyltransferase. This is a family of Dolichyl-phosphate-mannose-protein mannosyltransferase proteins EC:2.4.1.109. These proteins are responsible for O-linked glycosylation of proteins, they catalyze the reaction:- Dolichyl phosphate D-mannose + protein <=> dolichyl phosphate + O-D-mannosyl-protein. Also in this family is Drosophila rotated abdomen protein which is a putative mannosyltransferase. This family appears to be distantly related to pfam02516 (A Bateman pers. obs.). This family also contains sequences from ArnTs (4-amino-4-deoxy-L-arabinose lipid A transferase). They catalyze the addition of 4-amino-4-deoxy-l-arabinose (l-Ara4N) to the lipid A moiety of the lipopolysaccharide. This is a critical modification enabling bacteria (e.g. Escherichia coli and Salmonella typhimurium) to resist killing by antimicrobial peptides such as polymyxins. Members such as undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase are predicted to have 12 trans-membrane regions. The N-terminal portion of these proteins is hypothesized to have a conserved glycosylation activity which is shared between distantly related oligosaccharyltransferases ArnT and PglB families.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AOH39317.1	0.0	1	530	1	530
BBK24580.1	1.78e-197	7	529	5	528
AXL21031.1	1.20e-99	23	526	25	516
ALG41392.1	3.69e-98	23	459	25	461
AVO73979.1	2.89e-97	23	459	25	461

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5EZM_A	2.50e-28	16	332	41	371	CrystalStructure of ArnT from Cupriavidus metallidurans in the apo state [Cupriavidus metallidurans CH34],5F15_A Crystal Structure of ArnT from Cupriavidus metallidurans bound to Undecaprenyl phosphate [Cupriavidus metallidurans CH34]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O67601	6.41e-27	5	327	1	309	Uncharacterized protein aq_1704 OS=Aquifex aeolicus (strain VF5) OX=224324 GN=aq_1704 PE=3 SV=1
O67270	1.55e-26	5	356	1	349	Uncharacterized protein aq_1220 OS=Aquifex aeolicus (strain VF5) OX=224324 GN=aq_1220 PE=3 SV=1
A8FRR0	2.18e-26	1	333	1	341	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Shewanella sediminis (strain HAW-EB3) OX=425104 GN=arnT PE=3 SV=1
A0KGY4	5.63e-25	28	357	24	367	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049) OX=380703 GN=arnT PE=3 SV=1
C5BDQ8	5.79e-25	31	333	29	341	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Edwardsiella ictaluri (strain 93-146) OX=634503 GN=arnT PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000009	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
7	29
85	107
128	150
165	187
199	221
251	273
285	302
306	325
334	356
361	383
390	412