CAZyme Information: MGYG000001613_01237

Basic Information

• Species: Allisonella pneumosintes
• Lineage: Bacteria; Firmicutes_C; Negativicutes; Veillonellales; Dialisteraceae; Allisonella; Allisonella pneumosintes
• CAZyme ID: MGYG000001613_01237
• CAZy Family: GH23
• CAZyme Description: Membrane-bound lytic murein transglycosylase C

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
212		24734.55	7.1646

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001613	1269637	MAG	China	Asia

• Gene Location: Start: 48925; End: 49563 Strand: -

Full Sequence      

MGKVIKNTDNNVKNIYKINNRYISPYEKKSIKVFTFFLALLCLLFLIIFKTNHYQPSKEV
KQLIMINSEKYKLQPEFLQAVIAVESKYNERAVSHIGAIGVMQLVPETAKWISEESGIPY
GDLKKPEINIPLGAWYLRYLLDKYDGNLELALAAYNAGRGNVDEWIETKQWPRDFNDIQQ
IPFPETREFVKLVIQTKEELKEEIRENLNNSD

Enzyme Prediction     

No EC number prediction in MGYG000001613_01237.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	67	202	2.2e-30	0.8740740740740741

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd16896	LT_Slt70-like	2.87e-63	61	198	5	145	uncharacterized lytic transglycosylase subfamily with similarity to Slt70. Uncharacterized lytic transglycosylase (LT) with a conserved sequence pattern suggesting similarity to the Slt70, a 70kda soluble lytic transglycosylase which also has an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd13401	Slt70-like	5.87e-50	61	194	7	143	70kDa soluble lytic transglycosylase (Slt70) and similar proteins. Catalytic domain of the 70kda soluble lytic transglycosylase (LT)-like proteins, which also have an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
cd00254	LT-like	4.40e-44	75	195	1	108	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
pfam01464	SLT	6.06e-33	64	177	1	114	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.
COG0741	MltE	3.96e-29	57	201	136	284	Soluble lytic murein transglycosylase and related regulatory proteins (some contain LysM/invasin domains) [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AOH39655.1	4.15e-139	15	212	1	198
BBK24355.1	2.37e-60	33	206	23	197
AXL22000.1	3.35e-41	75	201	57	186
CCC73618.1	1.47e-40	72	202	22	155
AVO73570.1	3.78e-40	72	202	54	187

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6FBT_A	5.08e-19	73	194	462	586	ChainA, Lytic murein transglycosylase [Pseudomonas aeruginosa]
5OHU_A	5.17e-19	73	194	491	615	TheX-ray Structure of Lytic Transglycosylase Slt from Pseudomonas aeruginosa [Pseudomonas aeruginosa]
6FCQ_A	1.27e-18	73	194	462	586	ChainA, Soluble lytic murein transglycosylase [Pseudomonas aeruginosa],6FCR_A Chain A, Soluble lytic murein transglycosylase [Pseudomonas aeruginosa],6FCS_A Chain A, Soluble lytic murein transglycosylase [Pseudomonas aeruginosa],6FCU_A Chain A, Soluble lytic murein transglycosylase [Pseudomonas aeruginosa]
6FC4_A	1.28e-18	73	194	463	587	ChainA, Soluble lytic murein transglycosylase [Pseudomonas aeruginosa]
1SLY_A	3.56e-15	77	194	470	592	ComplexOf The 70-Kda Soluble Lytic Transglycosylase With Bulgecin A [Escherichia coli]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O31608	1.10e-20	68	193	68	175	Putative murein lytic transglycosylase YjbJ OS=Bacillus subtilis (strain 168) OX=224308 GN=yjbJ PE=3 SV=1
P44888	2.28e-15	77	194	445	566	Putative soluble lytic murein transglycosylase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=slt PE=3 SV=1
P39434	4.31e-15	77	194	497	619	Soluble lytic murein transglycosylase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=slt PE=3 SV=2
O31976	5.16e-15	66	194	1426	1538	SPbeta prophage-derived uncharacterized transglycosylase YomI OS=Bacillus subtilis (strain 168) OX=224308 GN=yomI PE=3 SV=2
O64046	5.16e-15	66	194	1426	1538	Probable tape measure protein OS=Bacillus phage SPbeta OX=66797 GN=yomI PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000007	0.000018	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
30	49