CAZyme Information: MGYG000001614_00191

Basic Information

• Species: CAG-521 sp002329575
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Burkholderiales; Burkholderiaceae; CAG-521; CAG-521 sp002329575
• CAZyme ID: MGYG000001614_00191
• CAZy Family: GH23
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
693	MGYG000001614_2|CGC1	79635.15	9.7035

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001614	1536892	MAG	China	Asia

• Gene Location: Start: 69079; End: 71160 Strand: -

Full Sequence      

MSLSLKRFSLIGPTLCASLISAVLLCAPVNAASIPTQQTYASMIEELPAKERFLFIKELY
ENKKLAEIAHPEKFLPDEDEPLREYVQAWHLIDRARAQNFDEALENEILRFITEHDGLYI
AERLRTDWLLLKANEWNEKRQWGYFRQLRQELVWNKNEPAVVCWDIYHQLQLARKGTLRA
DKAESFFNVLKNAQYRDIGVCRRAANELIEKAPTLAFPRIAVLIQHNRISQARTIVNDLI
AQKRLPTSARQALNQPSRWYRQHRNRLAKQNKFVLQIAAYRLAGSNFDAAVRIADTLKGR
LNKQERSALWARLGYLAALNHDTKALDYYAKGGSTVCSSRLTANSNDCLEWRARSALRLE
RWDSLLSFIHAMPATLAKKEAWTYWQGVAYAQKGQTDNAKKCWEKLNNVRTFYGKLAAEA
LGNPIVYPLNIENPIDDDLIDDFGKQPAVVRARTFYEHGLIAEGNREWQWAIRNRSDQQL
LAAALWAEENLYLHRSINTAIRLALRMPVEHRLLYPRPFDDEIEKYSKKVQIDPNWVYGL
IRQESRFIAIAQSSVGANGLMQIMPATAKWIAKELAIEDFKPSSIYEINTNVRFGTFYLR
TLLDRLDNNIVLSTAGYNAGPNRAHRWRSTLTKPVEGAIFIETIPFNETRLYVQNVLANT
VEYAQAQSKKVNSFKALLGTVTPETNAVVNDKI

Enzyme Prediction     

No EC number prediction in MGYG000001614_00191.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	529	667	2.1e-23	0.8666666666666667

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd13401	Slt70-like	6.66e-69	514	664	1	150	70kDa soluble lytic transglycosylase (Slt70) and similar proteins. Catalytic domain of the 70kda soluble lytic transglycosylase (LT)-like proteins, which also have an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
cd16896	LT_Slt70-like	2.69e-50	516	659	1	143	uncharacterized lytic transglycosylase subfamily with similarity to Slt70. Uncharacterized lytic transglycosylase (LT) with a conserved sequence pattern suggesting similarity to the Slt70, a 70kda soluble lytic transglycosylase which also has an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
PRK11619	PRK11619	7.65e-45	344	663	310	624	lytic murein transglycosylase; Provisional
COG0741	MltE	8.26e-36	382	673	3	293	Soluble lytic murein transglycosylase and related regulatory proteins (some contain LysM/invasin domains) [Cell wall/membrane/envelope biogenesis].
cd00254	LT-like	4.84e-34	534	659	1	109	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBF22242.1	2.38e-112	48	685	159	787
QQS89613.1	6.93e-109	53	683	165	794
AJP56054.1	5.78e-107	28	684	33	668
SNU81162.1	3.15e-106	21	684	19	668
AJC15693.1	3.15e-106	21	684	19	668

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5MPQ_A	8.15e-73	290	664	187	556	BulgecinA: The key to a broad-spectrum inhibitor that targets lytic transglycosylases [Neisseria meningitidis]
6FPN_B	1.02e-72	290	664	197	566	Lytictransglycosylase in action [Neisseria meningitidis MC58]
5O24_A	1.12e-72	290	664	201	570	Lytictransglycosylase in action [Neisseria meningitidis]
5O29_A	1.28e-72	290	664	207	576	Lytictransglycosylase in action [Neisseria meningitidis]
5O2O_A	1.97e-72	290	664	227	596	Lytictransglycosylase in action [Neisseria meningitidis],6H5F_A LtgA disordered Helix [Neisseria meningitidis NM422]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P39434	2.53e-40	341	670	307	632	Soluble lytic murein transglycosylase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=slt PE=3 SV=2
P0AGC3	3.79e-39	341	663	307	625	Soluble lytic murein transglycosylase OS=Escherichia coli (strain K12) OX=83333 GN=slt PE=1 SV=1
P0AGC4	3.79e-39	341	663	307	625	Soluble lytic murein transglycosylase OS=Escherichia coli O157:H7 OX=83334 GN=slt PE=3 SV=1
P44888	7.50e-25	357	670	273	579	Putative soluble lytic murein transglycosylase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=slt PE=3 SV=1
O31608	1.37e-14	520	664	61	181	Putative murein lytic transglycosylase YjbJ OS=Bacillus subtilis (strain 168) OX=224308 GN=yjbJ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.001698	0.470050	0.527227	0.000557	0.000245	0.000199

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001614_00191.