CAZyme Information: MGYG000001615_00147

Basic Information

• Species: Eisenbergiella sp900548905
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Eisenbergiella; Eisenbergiella sp900548905
• CAZyme ID: MGYG000001615_00147
• CAZy Family: GT4
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
635	MGYG000001615_1|CGC4	73134.93	9.6384

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001615	6842156	MAG	China	Asia

• Gene Location: Start: 170823; End: 172730 Strand: +

Full Sequence      

MKLLLIIDQYDRGNNGTTMTAQRLAHTLSSHGHEVRVVSTGNSGNGKYLVKEYFLPPVVH
HIVTKQGMVFARPDEEVLREAIGWADLVHFLLPFLLGMKGLEIARELGVPHTAAFHVQPE
NITYTLHLGKQQAVNAWLYRFFWERFYKYFRHIHCPSSFIAGELRANNYSSKLHVISNGV
DPDFIYRKRPKPAKLKDKFIVLMIGRLSNEKRQDILIDAIAKSKYESRIQLVLAGQGLKY
GSYRYRSRKLTNKPVMRFFSHEKLLHLLSITDLYVHAADAEIEAISCIEAFSSGVVPVIA
DSPKSATPQFALDERSLFKAGNSDELAAKIDYWLEEAGERRRMEKRYSEHGREFALEDCV
RWMEQMFEEELQDYRKENRRLENRRKFAEGKRETAGVVYEEKHIVKLWTPLSFHVKDSYR
FFPSNPFFLLCGGLVRLLIYLLVVLFIKPVWGLKIEGRKNLKAVKGGAVTVCNHVHLLDC
VMVSYVLRCRNVCFPTLESNFRIPFIRHIIRLLGGIPIPESGQSFRRFLEATGSWVSGGN
WIHYYPEVVLHPYYQGIRGFKRGAFLTACEAGVPVIPMVISYRHPGGVSGLMRRKPCLTL
KILPPVEPPACENKRQQTIELMDTVYETMNHAYWE

Enzyme Prediction     

No EC number prediction in MGYG000001615_00147.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT4	195	345	4.2e-19	0.9625

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd03817	GT4_UGDG-like	3.79e-68	15	357	14	358	UDP-Glc:1,2-diacylglycerol 3-a-glucosyltransferase and similar proteins. This family is most closely related to the GT1 family of glycosyltransferases. UDP-glucose-diacylglycerol glucosyltransferase (EC 2.4.1.337, UGDG; also known as 1,2-diacylglycerol 3-glucosyltransferase) catalyzes the transfer of glucose from UDP-glucose to 1,2-diacylglycerol forming 3-D-glucosyl-1,2-diacylglycerol.
cd03801	GT4_PimA-like	2.04e-36	2	357	1	350	phosphatidyl-myo-inositol mannosyltransferase. This family is most closely related to the GT4 family of glycosyltransferases and named after PimA in Propionibacterium freudenreichii, which is involved in the biosynthesis of phosphatidyl-myo-inositol mannosides (PIM) which are early precursors in the biosynthesis of lipomannans (LM) and lipoarabinomannans (LAM), and catalyzes the addition of a mannosyl residue from GDP-D-mannose (GDP-Man) to the position 2 of the carrier lipid phosphatidyl-myo-inositol (PI) to generate a phosphatidyl-myo-inositol bearing an alpha-1,2-linked mannose residue (PIM1). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in certain bacteria and archaea.
COG0438	RfaB	1.15e-34	1	373	1	380	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].
cd07989	LPLAT_AGPAT-like	4.14e-31	444	626	3	184	Lysophospholipid Acyltransferases (LPLATs) of Glycerophospholipid Biosynthesis: AGPAT-like. Lysophospholipid acyltransferase (LPLAT) superfamily member: acyltransferases of de novo and remodeling pathways of glycerophospholipid biosynthesis which catalyze the incorporation of an acyl group from either acylCoAs or acyl-acyl carrier proteins (acylACPs) into acceptors such as glycerol 3-phosphate, dihydroxyacetone phosphate or lyso-phosphatidic acid. Included in this subgroup are such LPLATs as 1-acyl-sn-glycerol-3-phosphate acyltransferase (AGPAT, PlsC), Tafazzin (product of Barth syndrome gene), and similar proteins.
cd03814	GT4-like	3.75e-28	15	357	14	354	glycosyltransferase family 4 proteins. This family is most closely related to the GT4 family of glycosyltransferases and includes a sequence annotated as alpha-D-mannose-alpha(1-6)phosphatidyl myo-inositol monomannoside transferase from Bacillus halodurans. Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in bacteria and eukaryotes.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QCT71572.1	2.99e-151	1	374	1	374
ALU13529.1	2.99e-151	1	374	1	374
ADO38766.1	2.74e-149	1	374	1	374
ARD65372.1	8.32e-149	1	374	1	374
ANW99047.1	3.06e-147	1	630	3	610

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3QHP_A	5.47e-41	199	360	3	164	Crystalstructure of the catalytic domain of cholesterol-alpha-glucosyltransferase from Helicobacter pylori [Helicobacter pylori 26695],3QHP_B Crystal structure of the catalytic domain of cholesterol-alpha-glucosyltransferase from Helicobacter pylori [Helicobacter pylori 26695]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8CWR6	2.13e-12	1	300	1	312	Alpha-monoglucosyldiacylglycerol synthase OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) OX=171101 GN=spr0982 PE=1 SV=1
P26647	3.40e-06	449	581	47	180	1-acyl-sn-glycerol-3-phosphate acyltransferase OS=Escherichia coli (strain K12) OX=83333 GN=plsC PE=1 SV=1
P44848	5.83e-06	449	584	47	183	1-acyl-sn-glycerol-3-phosphate acyltransferase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=plsC PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000073	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001615_00147.