CAZyme Information: MGYG000001615_00416

Basic Information

• Species: Eisenbergiella sp900548905
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Eisenbergiella; Eisenbergiella sp900548905
• CAZyme ID: MGYG000001615_00416
• CAZy Family: GH5
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
369	MGYG000001615_2|CGC1	42807	5.8103

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001615	6842156	MAG	China	Asia

• Gene Location: Start: 93903; End: 95012 Strand: +

Full Sequence      

MDKIRGVNLGNWLVLEKWMHPALFEGTSAEDEDELCRQLPREELVKRLTAHRDAYITKED
FSYLSSKGINTVRIPVPHFLFGDDPAYCEPYVPCVEYLDRAFAWAEETGLSVLIDVHTAP
ESQNGFDNGGICGVCKWAQKPERVERLLRVLEKLALRYGRHPSLWGIQLLNEPVSEPLWQ
MVRYKYLPHNPERAAGSSFVPLDVLYDFYTRGYHMLRSILPEDKKIVFHDGFRFEAWEPF
FRKAGFTNVVLDAHWYLGMGLPGEDTSELDYMRAILKEHVKKLKAMEKTVPVIVGEWCLS
HNLQPDKDYTKLEKQLSYKLVGDAQLMAWEACSGYFFWSYKLVSEPEGWDFRKCVEKGWL
PGNLENGRD

Enzyme Prediction     

EC	3.2.1.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	51	341	4.6e-105	0.9933774834437086

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG2730	BglC	4.84e-29	1	361	15	382	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].
pfam00150	Cellulase	1.08e-07	51	318	20	255	Cellulase (glycosyl hydrolase family 5).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QOS79423.1	3.61e-132	1	363	1	369
AZK47550.1	8.98e-122	4	361	3	385
QRT49144.1	1.27e-121	3	361	2	386
QQR01615.1	1.61e-120	4	369	3	394
ARE65151.1	1.61e-120	4	369	3	394

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6ZB9_A	5.88e-109	3	364	2	390	ChainA, Exo-beta-1,3-glucanase [uncultured bacterium],6ZB9_B Chain B, Exo-beta-1,3-glucanase [uncultured bacterium]
6ZB8_A	4.73e-108	3	364	2	390	ChainA, Exo-beta-1,3-glucanase variant E167Q/E295Q [uncultured bacterium],6ZB8_B Chain B, Exo-beta-1,3-glucanase variant E167Q/E295Q [uncultured bacterium]
2PF0_A	1.50e-36	4	361	15	385	ChainA, Hypothetical protein XOG1 [Candida albicans]
1CZ1_A	2.61e-36	4	361	9	379	Exo-b-(1,3)-glucanaseFrom Candida Albicans At 1.85 A Resolution [Candida albicans],1EQC_A Exo-b-(1,3)-glucanase From Candida Albicans In Complex With Castanospermine At 1.85 A [Candida albicans]
2PB1_A	2.90e-36	4	361	15	385	Exo-B-(1,3)-Glucanasefrom Candida Albicans in complex with unhydrolysed and covalently linked 2,4-dinitrophenyl-2-deoxy-2-fluoro-B-D-glucopyranoside at 1.9 A [Candida albicans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q7Z9L3	2.46e-48	2	361	29	393	Glucan 1,3-beta-glucosidase A OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=exgA PE=1 SV=1
B8N151	2.46e-48	2	361	29	393	Probable glucan 1,3-beta-glucosidase A OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=exgA PE=3 SV=1
Q0CR35	6.12e-48	2	366	38	408	Probable glucan 1,3-beta-glucosidase A OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=exgA PE=3 SV=1
A2RAR6	9.31e-46	4	361	42	403	Probable glucan 1,3-beta-glucosidase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=exgA PE=3 SV=1
Q5B5X8	2.02e-45	2	364	27	394	Probable glucan 1,3-beta-glucosidase A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=exgA PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000038	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001615_00416.