CAZyme Information: MGYG000001615_00713

Basic Information

• Species: Eisenbergiella sp900548905
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Eisenbergiella; Eisenbergiella sp900548905
• CAZyme ID: MGYG000001615_00713
• CAZy Family: GT11
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
271	MGYG000001615_3|CGC4	31718.99	7.7615

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001615	6842156	MAG	China	Asia

• Gene Location: Start: 103901; End: 104716 Strand: +

Full Sequence      

MFQYALYLSLKAAGKVVKIDDVSDYQAPDRRPQQLWVFDAPYRKASREEIVYLTDSSMDP
LSRIRRKLTGRKNLTYREKDMEFDPMVYRKDPAYLVGSFQSEAYFKEIRERVRHAFLFKN
LSLPDGYKDYLTAIEREMSVSVHIRRGDYLDPGHQGIYESICTRSYYEQAINLIKDRYPE
ARFYLFTNDVEWTKNNLSGQGRTVVEGGSEETGYLDMYLMSRCRHNIIANSSFSWWGAWL
NANPGKIVIAPSTWLNGMECGSIYTEDMIRI

Enzyme Prediction     

No EC number prediction in MGYG000001615_00713.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT11	1	259	1.8e-63	0.8913043478260869

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd11301	Fut1_Fut2_like	1.63e-58	1	256	15	257	Alpha-1,2-fucosyltransferase. Alpha-1,2-fucosyltransferases (Fut1, Fut2) catalyze the transfer of alpha-L-fucose to the terminal beta-D-galactose residue of glycoconjugates via an alpha-1,2-linkage, generating carbohydrate structures that exhibit H-antigenicity for blood-group carbohydrates. These structures also act as ligands for morphogenesis, the adhesion of microbes, and metastasizing cancer cells. Fut1 is responsible for producing the H antigen on red blood cells. Fut2 is expressed in epithelia of secretory tissues, and individuals termed "secretors" have at least one functional copy of the gene; they secrete H antigen which is further processed into A and/or B antigens depending on the ABO genotype. O-fucosyltransferase-like proteins are GDP-fucose dependent enzymes with similarities to the family 1 glycosyltransferases (GT1). They are soluble ER proteins that may be proteolytically cleaved from a membrane-associated preprotein, and are involved in the O-fucosylation of protein substrates, the core fucosylation of growth factor receptors, and other processes.
pfam01531	Glyco_transf_11	1.23e-25	92	254	123	278	Glycosyl transferase family 11. This family contains several fucosyl transferase enzymes.
cd11548	NodZ_like	1.20e-04	107	236	135	276	Alpha 1,6-fucosyltransferase similar to Bradyrhizobium NodZ. Bradyrhizobium NodZ is an alpha 1,6-fucosyltransferase involved in the biosynthesis of the nodulation factor, a lipo-chitooligosaccharide formed by three-to-six beta-1,4-linked N-acetyl-d-glucosamine (GlcNAc) residues and a fatty acid acyl group attached to the nitrogen atom at the non-reducing end. NodZ transfers L-fucose from the GDP-beta-L-fucose donor to the reducing residue of the chitin oligosaccharide backbone, before the attachment of a fatty acid group. O-fucosyltransferase-like proteins are GDP-fucose dependent enzymes with similarities to the family 1 glycosyltransferases (GT1). They are soluble ER proteins that may be proteolytically cleaved from a membrane-associated preprotein, and are involved in the O-fucosylation of protein substrates, the core fucosylation of growth factor receptors, and other processes.
cd11296	O-FucT_like	0.006	114	236	42	196	GDP-fucose protein O-fucosyltransferase and related proteins. O-fucosyltransferase-like proteins are GDP-fucose dependent enzymes with similarities to the family 1 glycosyltransferases (GT1). They are soluble ER proteins that may be proteolytically cleaved from a membrane-associated preprotein, and are involved in the O-fucosylation of protein substrates, the core fucosylation of growth factor receptors, and other processes.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADL35260.1	4.55e-75	1	271	14	288
AOZ97425.1	1.35e-71	1	271	14	288
SNX52916.1	1.37e-59	1	256	14	270
QCT75971.1	2.17e-51	1	271	14	283
QRM68592.1	2.17e-51	1	271	14	283

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q58YV9	7.44e-30	135	271	165	302	O-antigen biosynthesis glycosyltransferase WbnK OS=Escherichia coli OX=562 GN=wbnK PE=1 SV=1
O09160	7.51e-12	90	240	160	319	Galactoside alpha-(1,2)-fucosyltransferase 1 OS=Mus musculus OX=10090 GN=Fut1 PE=1 SV=2
P19526	9.71e-12	90	240	158	317	Galactoside alpha-(1,2)-fucosyltransferase 1 OS=Homo sapiens OX=9606 GN=FUT1 PE=1 SV=1
Q9TUD6	9.75e-12	90	240	159	318	Galactoside alpha-(1,2)-fucosyltransferase 1 OS=Pan troglodytes OX=9598 GN=FUT1 PE=3 SV=1
Q9TUD4	1.78e-11	91	240	160	318	Galactoside alpha-(1,2)-fucosyltransferase 1 OS=Gorilla gorilla gorilla OX=9595 GN=FUT1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000045	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001615_00713.