CAZyme Information: MGYG000001615_00825

Basic Information

• Species: Eisenbergiella sp900548905
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Eisenbergiella; Eisenbergiella sp900548905
• CAZyme ID: MGYG000001615_00825
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
671	MGYG000001615_3|CGC7	76673.69	6.4689

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001615	6842156	MAG	China	Asia

• Gene Location: Start: 249001; End: 251016 Strand: +

Full Sequence      

MEQNKNEQKEEPFVPKTGAVLPEKDYKEAYEQERYKSTYLAGRVADLEDKVDDLQFKLDR
IKNNPIWKASTPLRKGMHFCIRQADRVKNCGSIGGVMTKIKYKANERKAMKHYGTESFPS
QEERKAQEETVFPKMVKISILTPLWNTPENFLREMIGSVQAQTYKNWELCLADGSDDAHS
YVGRICRELAEKDKRICYMKLEKNEGIAGNTNQCLTQATGEFIGLFDHDDLLHPCALYEY
VKAINEKNADYVYCDEATFKNGDINQMITMHFKPDYAIDNLRANNYICHFSVFSRELLDG
TQLFNTKFDGSQDHDMILRLTDRAGHVVHVPKLLYYWRWHPGSVASGIEAKPYAIESARG
AVADHLRKHGFSHFTITSTRAFETIFKITYEIIGEPKISIIIPNKDHVEDLRRCISSIIE
KSTYDNYEIVVVENNSETKEIFSYYEELGNNPSIRVVTYEGEFNYSAINNLGAAHAAGDY
VLLLNNDTQVITVNWMEELLMYAQRSDVGAVGGKLYYGDKTIQHAGIVIGLGAHRTAGHT
HYRQKRENLGYMGRLCYAQDVSAVTGACLLVKKALYREAGGLDEGFAVSLNDVDFCLKLR
KLGYLNVFTPFAELYHYESISRGLDTDGAKAARYNEESARFREKWKELLEAGDPYYNPNF
TLDKSDYSLRV

Enzyme Prediction     

No EC number prediction in MGYG000001615_00825.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	139	298	3.6e-24	0.9705882352941176
GT2	399	529	2e-21	0.7588235294117647

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd04184	GT2_RfbC_Mx_like	1.69e-83	137	338	2	201	Myxococcus xanthus RfbC like proteins are required for O-antigen biosynthesis. The rfbC gene encodes a predicted protein of 1,276 amino acids, which is required for O-antigen biosynthesis in Myxococcus xanthus. It is a subfamily of Glycosyltransferase Family GT2, which includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds.
cd04186	GT_2_like_c	2.10e-42	400	618	1	166	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
COG1216	GT2	2.02e-32	394	623	1	226	Glycosyltransferase, GT2 family [Carbohydrate transport and metabolism].
cd06433	GT_2_WfgS_like	3.41e-24	139	343	1	199	WfgS and WfeV are involved in O-antigen biosynthesis. Escherichia coli WfgS and Shigella dysenteriae WfeV are glycosyltransferase 2 family enzymes involved in O-antigen biosynthesis. GT-2 enzymes have GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
pfam00535	Glycos_transf_2	2.76e-23	139	298	1	164	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADL33299.1	0.0	21	671	1	673
AOZ95572.1	0.0	21	671	1	675
QNM02106.1	0.0	21	670	1	678
QUO22278.1	2.32e-294	42	670	5	629
CAB1243278.1	7.72e-245	24	670	383	1033

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5HEA_A	1.59e-11	138	337	7	215	CgTstructure in hexamer [Streptococcus parasanguinis FW213],5HEA_B CgT structure in hexamer [Streptococcus parasanguinis FW213],5HEA_C CgT structure in hexamer [Streptococcus parasanguinis FW213],5HEC_A CgT structure in dimer [Streptococcus parasanguinis FW213],5HEC_B CgT structure in dimer [Streptococcus parasanguinis FW213]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P55465	2.14e-121	138	669	368	897	Uncharacterized protein y4gI OS=Sinorhizobium fredii (strain NBRC 101917 / NGR234) OX=394 GN=NGR_a03550 PE=4 SV=1
Q50864	1.39e-83	138	670	321	841	O-antigen biosynthesis protein RfbC OS=Myxococcus xanthus OX=34 GN=rfbC PE=4 SV=1
Q1RIM7	1.74e-12	138	487	15	379	Uncharacterized glycosyltransferase RBE_0706 OS=Rickettsia bellii (strain RML369-C) OX=336407 GN=RBE_0706 PE=3 SV=1
A0A0H2URH7	9.18e-12	137	251	6	112	Glycosyltransferase GlyA OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=glyA PE=3 SV=1
Q7BLV3	1.45e-11	128	509	432	832	Hyaluronan synthase OS=Pasteurella multocida OX=747 GN=hyaD PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000085	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001615_00825.