CAZyme Information: MGYG000001615_00927

Basic Information

• Species: Eisenbergiella sp900548905
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Eisenbergiella; Eisenbergiella sp900548905
• CAZyme ID: MGYG000001615_00927
• CAZy Family: GH5
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
533	MGYG000001615_4|CGC2	60684.91	5.0869

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001615	6842156	MAG	China	Asia

• Gene Location: Start: 90435; End: 92036 Strand: +

Full Sequence      

MKGFLHTEGKKITDGSGKEILLTGWGLGNWLLQEGYMWKAYGERFDRPSRIEKCVEELTG
REFASYFWKKYRENYIRREDILAMAALGYNSVRIPFSYRLFMEDGPGIRWKEEGFALLDQ
CLAWCEEAGMYAFLDLHGAPGGQTGSNIDDSVDNVPRLFIDRDCRDKACALWRKLALRYS
SREAVGGYDLLNEPLIPPEAGNGDYDYLLPALESFYEEVITEIRKVDTGHMLSIEGAHWA
TDVRIFHKKYDDNMVLHFHRYAEMPDKACLNRFIEAAGRLDVPLWMGETGENTNPWYAAL
YPLAGALGIGYNLWPWKKMDTANSPCSIRVPEGYHEILSYLEKGPHPGYERAQQILEEYL
VNIRYENCEQHPEVTAHVFRRPPFSMQAVDFDAVPGEGVSWKGNGLPGKDKPYRKDTSLE
IRERDTVWDKKFAFDCGWERLDLVLHAGEYACYSLDCSLCPGQELKLALTCRTEEEAVVQ
ISRDGGDTIQVILHKNEKEAAVSLGVIPPGTGNTTIKIEILRGTVLFGQLHIT

Enzyme Prediction     

No EC number prediction in MGYG000001615_00927.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	64	320	8.5e-91	0.9844357976653697

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00150	Cellulase	3.38e-21	65	316	16	268	Cellulase (glycosyl hydrolase family 5).
COG2730	BglC	9.45e-15	74	207	72	206	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBI31985.1	6.41e-207	1	525	10	531
AIQ47223.1	1.84e-201	3	530	12	537
AIQ52770.1	3.70e-201	3	530	12	537
QSF47399.1	1.22e-194	1	530	10	537
BCK01130.1	9.40e-191	1	531	6	548

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1CEC_A	2.40e-17	67	261	20	200	ChainA, ENDOGLUCANASE CELC [Acetivibrio thermocellus]
1CEN_A	5.83e-17	67	261	20	200	ChainA, CELLULASE CELC [Acetivibrio thermocellus],1CEO_A Chain A, CELLULASE CELC [Acetivibrio thermocellus]
6ZB9_A	2.98e-14	22	276	3	269	ChainA, Exo-beta-1,3-glucanase [uncultured bacterium],6ZB9_B Chain B, Exo-beta-1,3-glucanase [uncultured bacterium]
1H4P_A	4.38e-14	22	213	13	213	Crystalstructure of exo-1,3-beta glucanse from Saccharomyces cerevisiae [Saccharomyces cerevisiae],1H4P_B Crystal structure of exo-1,3-beta glucanse from Saccharomyces cerevisiae [Saccharomyces cerevisiae]
6ZB8_A	7.07e-14	22	276	3	269	ChainA, Exo-beta-1,3-glucanase variant E167Q/E295Q [uncultured bacterium],6ZB8_B Chain B, Exo-beta-1,3-glucanase variant E167Q/E295Q [uncultured bacterium]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
W8QRE4	5.09e-35	4	262	3	249	Beta-xylosidase OS=Phanerodontia chrysosporium OX=2822231 GN=Xyl5 PE=1 SV=2
Q875R9	9.02e-17	4	247	31	290	Glucan 1,3-beta-glucosidase OS=Lachancea kluyveri (strain ATCC 58438 / CBS 3082 / BCRC 21498 / NBRC 1685 / JCM 7257 / NCYC 543 / NRRL Y-12651) OX=226302 GN=EXG1 PE=3 SV=1
A3DJ77	9.79e-17	67	261	20	200	Endoglucanase C OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=celC PE=3 SV=1
P23340	9.79e-17	67	261	20	200	Endoglucanase C307 OS=Clostridium sp. (strain F1) OX=1508 GN=celC307 PE=1 SV=1
Q8NKF9	1.10e-16	22	275	37	294	Glucan 1,3-beta-glucosidase OS=Candida oleophila OX=45573 GN=EXG1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000044	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001615_00927.