CAZyme Information: MGYG000001615_02517

Basic Information

• Species: Eisenbergiella sp900548905
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Eisenbergiella; Eisenbergiella sp900548905
• CAZyme ID: MGYG000001615_02517
• CAZy Family: GH67
• CAZyme Description: Xylan alpha-(1->2)-glucuronosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
665	MGYG000001615_16|CGC1	76154.24	5.2913

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001615	6842156	MAG	China	Asia

• Gene Location: Start: 40079; End: 42076 Strand: -

Full Sequence      

MDYNLAWLSYRNIPWYEDRKFFQIINTREKHVVIKTAVAELCRAAEEMFGMQPEITDRQE
RKDNFGKNRICLVMDAGISVAGGYRIEEYGGQISIFSGDASGILYGTYALVRRVQRELPL
TGLKLQELPDMPLRMLNHWDNMDGSIERGYAGSSFFFKEGEILLNDRTRDYIRLAASVGI
NGVVINNVNVSGDATRLITDEYELSLKRMAAELEAYGITLYLSLNFAAPIELGDLDTADP
EAEEVQSWWKEKMARLFQRIPNLGGFLVKADSEGRPGPFTYGRTHAQGANMLADMIKPYG
GLIIWRCFVYNCTQDWRDKKTDRARSAYDNFMPLDGQFAENVILQIKNGPMDFQVREPVS
PLFGSLEKTNQILEVQIAQEYTGQQKHVCYLIPMFKEILDFHTYCRKTKDKVSDIVSGRT
FLQTECGMAAVANTGSDRNWTGHDLAAANWFGFGRLAFSASLTAEEIAEEWCECTFGPDR
ETAAAVTGILMMSWPAYEKYTSPLGIGWMVNPGNHYGPNVDGYEYDRWGTYHRADHRGIG
VERGRAGTGYTSTYLEPNAAMYENIASCPEELLLFFHYIPYDYKMKSGKTLIQHIYDTHF
EGVEDVEKMIGIWEGIRGKIPEEIFRRVKERLNHQQEHAEEWRDQVNTYFYRKSFIADEK
GRKIY

Enzyme Prediction     

EC	3.2.1.139	3.2.1.131

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH67	6	662	2.9e-277	0.992526158445441

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3661	AguA2	0.0	7	665	11	682	Alpha-glucuronidase [Carbohydrate transport and metabolism].
pfam07488	Glyco_hydro_67M	0.0	113	439	1	324	Glycosyl hydrolase family 67 middle domain. Alpha-glucuronidases, components of an ensemble of enzymes central to the recycling of photosynthetic biomass, remove the alpha-1,2 linked 4-O-methyl glucuronic acid from xylans. This family represents the central catalytic domain of alpha-glucuronidase.
pfam07477	Glyco_hydro_67C	4.73e-139	441	663	1	223	Glycosyl hydrolase family 67 C-terminus. Alpha-glucuronidases, components of an ensemble of enzymes central to the recycling of photosynthetic biomass, remove the alpha-1,2 linked 4-O-methyl glucuronic acid from xylans. This family represents the C terminal region of alpha-glucuronidase which is mainly alpha-helical. It wraps around the catalytic domain (pfam07488), making additional interactions both with the N-terminal domain (pfam03648) of its parent monomer and also forming the majority of the dimer-surface with the equivalent C-terminal domain of the other monomer of the dimer.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCJ97914.1	0.0	1	665	1	668
QJU15649.1	0.0	3	665	5	661
QQQ91839.1	0.0	3	665	5	661
ANU78479.1	0.0	3	665	12	668
ASU31294.1	0.0	3	665	5	661

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1K9D_A	2.21e-260	3	665	5	678	The1.7 A crystal structure of alpha-D-glucuronidase, a family-67 glycoside hydrolase from Bacillus stearothermophilus T-1 [Geobacillus stearothermophilus],1L8N_A The 1.5A crystal structure of alpha-D-glucuronidase from Bacillus stearothermophilus T-1, complexed with 4-O-methyl-glucuronic acid and xylotriose [Geobacillus stearothermophilus],1MQQ_A THE CRYSTAL STRUCTURE OF ALPHA-D-GLUCURONIDASE FROM BACILLUS STEAROTHERMOPHILUS T-1 COMPLEXED WITH GLUCURONIC ACID [Geobacillus stearothermophilus]
1MQP_A	4.45e-260	3	665	5	678	TheCrystal Structure Of Alpha-D-Glucuronidase From Bacillus Stearothermophilus T-6 [Geobacillus stearothermophilus]
1MQR_A	1.27e-259	3	665	5	678	ChainA, ALPHA-D-GLUCURONIDASE [Geobacillus stearothermophilus]
1K9E_A	2.55e-259	3	665	5	678	ChainA, alpha-D-glucuronidase [Geobacillus stearothermophilus],1K9F_A Chain A, alpha-D-glucuronidase [Geobacillus stearothermophilus]
1GQI_A	1.61e-151	102	650	119	663	Structureof Pseudomonas cellulosa alpha-D-glucuronidase [Cellvibrio japonicus],1GQI_B Structure of Pseudomonas cellulosa alpha-D-glucuronidase [Cellvibrio japonicus],1GQJ_A Structure of Pseudomonas cellulosa alpha-D-glucuronidase complexed with xylobiose [Cellvibrio japonicus],1GQJ_B Structure of Pseudomonas cellulosa alpha-D-glucuronidase complexed with xylobiose [Cellvibrio japonicus],1GQK_A Structure of Pseudomonas cellulosa alpha-D-glucuronidase complexed with glucuronic acid [Cellvibrio japonicus],1GQK_B Structure of Pseudomonas cellulosa alpha-D-glucuronidase complexed with glucuronic acid [Cellvibrio japonicus],1GQL_A Structure of Pseudomonas cellulosa alpha-D-glucuronidase complexed with glucuronic acid and xylotriose [Cellvibrio japonicus],1GQL_B Structure of Pseudomonas cellulosa alpha-D-glucuronidase complexed with glucuronic acid and xylotriose [Cellvibrio japonicus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q09LY5	2.44e-259	3	665	5	678	Xylan alpha-(1->2)-glucuronosidase OS=Geobacillus stearothermophilus OX=1422 GN=aguA PE=1 SV=1
P96105	6.28e-251	1	665	1	673	Xylan alpha-(1->2)-glucuronosidase OS=Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) OX=243274 GN=aguA PE=1 SV=2
Q5AQZ4	9.02e-166	6	662	23	699	Alpha-glucuronidase A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=aguA PE=1 SV=1
A1CC12	1.82e-163	83	662	114	692	Probable alpha-glucuronidase A OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=aguA PE=3 SV=1
Q96WX9	1.87e-163	83	662	114	692	Probable alpha-glucuronidase A OS=Aspergillus niger OX=5061 GN=aguA PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000074	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001615_02517.