CAZyme Information: MGYG000001615_02945

Basic Information

• Species: Eisenbergiella sp900548905
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Eisenbergiella; Eisenbergiella sp900548905
• CAZyme ID: MGYG000001615_02945
• CAZy Family: GH50
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
668		76647.92	5.2546

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001615	6842156	MAG	China	Asia

• Gene Location: Start: 53434; End: 55440 Strand: +

Full Sequence      

MNIDFRRSQARDAGILEADEKGCTVLLGAGGGGISLPQVNEGEGRYLTGDVEVLEDHSTA
MMFRCFLPGEEKERLFMRFGILPRFKTRICLDLDLLDNRTIFTNRTPGTLKLVVHGQRTR
REDVERFELGMDEMYHGVTVRLENFSLTDTFPEEFPVPKKKMVDVFGQWKGGEWPGKIHS
IEELKETYHRMEGAAAYPFPEWNIWGGDSRRKLKEGTGYFSTFKSADGRWHLTDPEGCDY
FSLGPCGTRAGEWGRIDSFEDCCDWLPREDSSYAEFLEEGSRRRTAYMPVDHYKMANFSG
MNLKKVYGSAWKEKWEEISCHILMGSGINSQGNFPGLGVGCGNGRLAYVRELPGFPVTQT
LIFRDFPDVLSPEYRERSEAYARQLEAWKEDRWLIGYFLRNEPEFNFVENLAIADEVLRN
PAQTFCRKGLLAFLQEKYTSVEALNRVWGTGFCSFGDLEKPIPDCSRRYPGSEKDIREFS
GKLITEYIRIPSLACRAVDPNHLNLGLRWSKAYNGDMMKGWEYFDVFSINCYDFDPTRDM
DFVKNAGVDLPILLGEFHCGALDRGLTATGLKGVADQKERGVMWRYFVEKVAAHPYGVAA
HWFQYNDQFCLGRYDGENYQIGMVDVCMQPYPELMEAVFETSRVLYEVKNGEKQPYDRKP
KPVPMIGY

Enzyme Prediction     

No EC number prediction in MGYG000001615_02945.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH50	116	646	1.9e-94	0.8407350689127105

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam02449	Glyco_hydro_42	1.03e-04	371	543	105	257	Beta-galactosidase. This group of beta-galactosidase enzymes belong to the glycosyl hydrolase 42 family. The enzyme catalyzes the hydrolysis of terminal, non-reducing terminal beta-D-galactosidase residues.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGG55910.1	0.0	1	668	1	669
BCJ99952.1	0.0	1	668	1	669
AZP03585.1	0.0	1	668	1	669
QFR63110.1	2.67e-166	16	668	16	658
QFR24656.1	2.67e-166	16	668	16	658

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4BQ2_A	6.76e-52	124	653	166	750	Structuralanalysis of an exo-beta-agarase [Saccharophagus degradans 2-40],4BQ2_B Structural analysis of an exo-beta-agarase [Saccharophagus degradans 2-40],4BQ2_C Structural analysis of an exo-beta-agarase [Saccharophagus degradans 2-40],4BQ2_D Structural analysis of an exo-beta-agarase [Saccharophagus degradans 2-40],4BQ3_A Structural analysis of an exo-beta-agarase [Saccharophagus degradans 2-40],4BQ3_B Structural analysis of an exo-beta-agarase [Saccharophagus degradans 2-40],4BQ3_C Structural analysis of an exo-beta-agarase [Saccharophagus degradans 2-40],4BQ3_D Structural analysis of an exo-beta-agarase [Saccharophagus degradans 2-40]
4BQ4_A	1.71e-51	124	653	166	750	Structuralanalysis of an exo-beta-agarase [Saccharophagus degradans 2-40],4BQ4_B Structural analysis of an exo-beta-agarase [Saccharophagus degradans 2-40],4BQ5_A Structural analysis of an exo-beta-agarase [Saccharophagus degradans 2-40],4BQ5_B Structural analysis of an exo-beta-agarase [Saccharophagus degradans 2-40]
5Z6P_A	1.65e-46	124	646	185	759	Thecrystal structure of an agarase, AgWH50C [Agarivorans gilvus],5Z6P_B The crystal structure of an agarase, AgWH50C [Agarivorans gilvus]
6XJ9_A	7.52e-46	124	647	185	760	Structureof PfGH50B [Pseudoalteromonas fuliginea],6XJ9_B Structure of PfGH50B [Pseudoalteromonas fuliginea]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P48840	7.18e-55	162	649	431	952	Beta-agarase B OS=Vibrio sp. (strain JT0107) OX=47913 GN=agaB PE=3 SV=1
P48839	2.23e-34	161	646	397	913	Beta-agarase A OS=Vibrio sp. (strain JT0107) OX=47913 GN=agaA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000066	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001615_02945.