CAZyme Information: MGYG000001615_03203

Basic Information

• Species: Eisenbergiella sp900548905
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Eisenbergiella; Eisenbergiella sp900548905
• CAZyme ID: MGYG000001615_03203
• CAZy Family: GH42
• CAZyme Description: Beta-galactosidase LacZ

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
669	MGYG000001615_23|CGC2	76472.56	5.2863

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001615	6842156	MAG	China	Asia

• Gene Location: Start: 76675; End: 78684 Strand: +

Full Sequence      

MKSQFKRILYGGDYNPNQWPREIWEEDMRIFRNARINSATVNVFSWAKIQPAEERYDFSE
LDDIVDMLSRENYDIVLATSTAALPAWMVKRYPEVSRTDYEGRHHKFGQRHNACPNSPVY
QRYASALAKKLAERYGKNGRIACWHVNNEYGGECYCENCEKAFRIGLRKKYKSLEALNLA
WNLEFWGHTIYDWDEIVLPNALSEGLQGGKTAFAGISIDYRRFMSDSMLSNYRMERDSIR
HFDKEAPITTNLMGTYKGLDYFKWAKEMDVVSWDNYPRYDTPWSYTAMCHDLMRGLKDAP
FMLMEQTPSQQNWQQYNSLKKPGQMRAQSYQTIAHGADTIQFFQLRRSAGACEKFHGAVI
EHAGTDDTRVFREVRRLGLELERLSAVTPGSVNEAETGIIFDWDNYWALEYTSGPSVDLT
YVKHIHQYYTYFYERNIPVNLIPFDADFSRYKVVVAPVLYMIKEGMKEALTSFVEKGGVL
ILTYMCGIADQSDNVFPGGYPGPLRELAGVWVEEIDALSPEQSNKVVFKDGTKVSCGLVC
ELMHTEGAEILAEYGSDFYAGRPAVTRNHFGEGVVYYIGTNAEAEGLSRVMDMAAADAAV
QPVISGAGGLEITCRETEVCRLYFVLNFKDQELPVPEGLTGYTDMITGEKVPEGEMLSKY
DVKIIRVEK

Enzyme Prediction     

EC	3.2.1.23

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH42	13	382	1.5e-152	0.9946091644204852

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1874	GanA	0.0	8	666	16	671	Beta-galactosidase GanA [Carbohydrate transport and metabolism].
pfam02449	Glyco_hydro_42	0.0	13	384	1	376	Beta-galactosidase. This group of beta-galactosidase enzymes belong to the glycosyl hydrolase 42 family. The enzyme catalyzes the hydrolysis of terminal, non-reducing terminal beta-D-galactosidase residues.
pfam08532	Glyco_hydro_42M	5.26e-79	395	587	1	193	Beta-galactosidase trimerisation domain. This is non catalytic domain B of beta-galactosidase enzymes belong to the glycosyl hydrolase 42 family. This domain is related to glutamine amidotransferase enzymes, but the catalytic residues are replaced by non functional amino acids. This domain is involved in trimerisation.
cd03143	A4_beta-galactosidase_middle_domain	2.24e-33	397	518	1	123	A4 beta-galactosidase middle domain: a type 1 glutamine amidotransferase (GATase1)-like domain. A4 beta-galactosidase middle domain: a type 1 glutamine amidotransferase (GATase1)-like domain. This group includes proteins similar to beta-galactosidase from Thermus thermophilus. Beta-Galactosidase hydrolyzes the beta-1,4-D-galactosidic linkage of lactose, as well as those of related chromogens, o-nitrophenyl-beta-D-galactopyranoside (ONP-Gal) and 5-bromo-4-chloro-3-indolyl-beta-D-galactoside (X-gal). This A4 beta-galactosidase middle domain lacks the catalytic triad of typical GATase1 domains. The reactive Cys residue found in the sharp turn between a beta strand and an alpha helix termed the nucleophile elbow in typical GATase1 domains is not conserved in this group.
pfam08533	Glyco_hydro_42C	1.11e-06	609	666	1	57	Beta-galactosidase C-terminal domain. This domain is found at the C-terminus of beta-galactosidase enzymes that belong to the glycosyl hydrolase 42 family.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QMW78317.1	0.0	1	668	1	668
QIB53799.1	0.0	1	668	1	668
QBE98512.1	0.0	1	668	1	668
QRT50775.1	0.0	1	665	1	669
AYY10968.1	0.0	1	666	1	665

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3TTS_A	4.40e-270	1	651	2	658	ChainA, Beta-galactosidase [Niallia circulans subsp. alkalophilus],3TTS_B Chain B, Beta-galactosidase [Niallia circulans subsp. alkalophilus],3TTS_C Chain C, Beta-galactosidase [Niallia circulans subsp. alkalophilus],3TTS_D Chain D, Beta-galactosidase [Niallia circulans subsp. alkalophilus],3TTS_E Chain E, Beta-galactosidase [Niallia circulans subsp. alkalophilus],3TTS_F Chain F, Beta-galactosidase [Niallia circulans subsp. alkalophilus],3TTY_A Chain A, Beta-galactosidase [Niallia circulans subsp. alkalophilus],3TTY_B Chain B, Beta-galactosidase [Niallia circulans subsp. alkalophilus],3TTY_C Chain C, Beta-galactosidase [Niallia circulans subsp. alkalophilus],3TTY_D Chain D, Beta-galactosidase [Niallia circulans subsp. alkalophilus],3TTY_E Chain E, Beta-galactosidase [Niallia circulans subsp. alkalophilus],3TTY_F Chain F, Beta-galactosidase [Niallia circulans subsp. alkalophilus]
5E9A_A	5.42e-164	1	665	32	706	Crystalstructure analysis of the cold-adamped beta-galactosidase from Rahnella sp. R3 [Rahnella sp. R3],5E9A_B Crystal structure analysis of the cold-adamped beta-galactosidase from Rahnella sp. R3 [Rahnella sp. R3],5E9A_C Crystal structure analysis of the cold-adamped beta-galactosidase from Rahnella sp. R3 [Rahnella sp. R3],5E9A_D Crystal structure analysis of the cold-adamped beta-galactosidase from Rahnella sp. R3 [Rahnella sp. R3],5E9A_E Crystal structure analysis of the cold-adamped beta-galactosidase from Rahnella sp. R3 [Rahnella sp. R3],5E9A_F Crystal structure analysis of the cold-adamped beta-galactosidase from Rahnella sp. R3 [Rahnella sp. R3]
4OIF_A	3.87e-160	3	665	10	682	3Dstructure of Gan42B, a GH42 beta-galactosidase from G. [Geobacillus stearothermophilus],4OIF_B 3D structure of Gan42B, a GH42 beta-galactosidase from G. [Geobacillus stearothermophilus],4OIF_C 3D structure of Gan42B, a GH42 beta-galactosidase from G. [Geobacillus stearothermophilus]
4OJY_A	3.99e-160	3	665	11	683	3Dstructure of the E323A catalytic mutant of Gan42B, a GH42 beta-galactosidase from G. stearothermophilus [Geobacillus stearothermophilus],4OJY_B 3D structure of the E323A catalytic mutant of Gan42B, a GH42 beta-galactosidase from G. stearothermophilus [Geobacillus stearothermophilus],4OJY_C 3D structure of the E323A catalytic mutant of Gan42B, a GH42 beta-galactosidase from G. stearothermophilus [Geobacillus stearothermophilus]
5DFA_A	3.07e-159	3	665	10	682	3Dstructure of the E323A catalytic mutant of Gan42B, a GH42 beta-galactosidase from G. stearothermophilus [Geobacillus stearothermophilus],5DFA_B 3D structure of the E323A catalytic mutant of Gan42B, a GH42 beta-galactosidase from G. stearothermophilus [Geobacillus stearothermophilus],5DFA_C 3D structure of the E323A catalytic mutant of Gan42B, a GH42 beta-galactosidase from G. stearothermophilus [Geobacillus stearothermophilus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q5FJ41	6.94e-262	3	666	2	666	Beta-galactosidase LacZ OS=Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM) OX=272621 GN=lacZ PE=1 SV=1
C6H178	5.27e-259	3	666	2	666	Beta-galactosidase LacA OS=Lactobacillus acidophilus OX=1579 GN=lacA PE=1 SV=1
Q9KI47	1.14e-255	1	665	2	674	Beta-galactosidase BgaA OS=Planococcus sp. (strain 'SOS Orange') OX=128803 GN=bgaA PE=1 SV=1
Q09HN2	8.35e-253	1	651	2	659	Beta-galactosidase BgaP OS=Planococcus sp. (strain L4) OX=377621 GN=bgaP PE=1 SV=1
D5JGG0	1.66e-187	1	667	1	662	Beta-galactosidase LacZ OS=Weizmannia coagulans OX=1398 GN=lacZ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000082	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001615_03203.