CAZyme Information: MGYG000001615_04115

Basic Information

• Species: Eisenbergiella sp900548905
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Eisenbergiella; Eisenbergiella sp900548905
• CAZyme ID: MGYG000001615_04115
• CAZy Family: CBM67
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
710	MGYG000001615_38|CGC1	79627.96	4.8394

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001615	6842156	MAG	China	Asia

• Gene Location: Start: 15892; End: 18024 Strand: -

Full Sequence      

MENKHWIQGDNVCESPLFRRSFYLEEVPASARLAICGLGYFLLFVNGERVGDQEFIPAMT
NYSSVLGCDTTYPVWEERSGYRCLYVVFDLLPFLKTGENVIGIQLGNGWYHQTKRVDEGK
FIFGFPKLRYEFTMAYGNGETVFLESGPETLWKPGEVTEHNLFCGEKLDLRLLQEDWCTG
SADLTGWKPARPVHAPEALLTQQSCPADRVLRSITPVLLEKDGGRSLYDCGENIAGWVSI
RCIGKKGETVLVRYSEELDRDGHDLDFLSAGGEGQIQEDCYIGNGSPVVVHPKFCWHGFR
YFTVEGPAEVVSASLVCSDIAVTSSFRCSDPVLNWLYEAYIRTQINNFHNGIPSDCPHRE
RLGYTGDGQLTSETAMLLLDTKALYEKWYQDILDSQGADTGHIPHTAPFLGGGGGPGGWG
CAVYVIPWNYYRIYGDTRLLEKGYPAILRWLDYMDSRCENGLVTREEEGGWCLGEWCAPA
AEPEMLPAAFVNTYYYIRGLEEAGKIAQLLHRPEPEWVQERIRLAKDAIERTWFHPETGA
FCEGIGAADAFALNLGLGNARTKEHLVERYQNLGRLDTGIFGTPVLLERLFLEGEAGLAF
QLLTNRGEVSFARMMENGATTLWENWEGTQSHNHPMFGSVVKLLFTEILGIRQKEGGCGY
AEYSVEPADIGALSWAEGSVRTKEGTIHVAWKRDEKGTLQITQNEKRKGK

Enzyme Prediction     

No EC number prediction in MGYG000001615_04115.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	222	702	2.8e-123	0.9682539682539683
CBM67	13	196	4.6e-18	0.8920454545454546

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	1.19e-83	323	645	3	337	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam08531	Bac_rhamnosid_N	3.02e-40	28	210	3	170	Alpha-L-rhamnosidase N-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. This domain is probably involved in substrate recognition.
pfam05592	Bac_rhamnosid	2.52e-12	220	318	2	98	Bacterial alpha-L-rhamnosidase concanavalin-like domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam17390	Bac_rhamnosid_C	2.29e-04	650	702	1	52	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AUS97255.1	1.34e-217	6	689	8	683
BCJ98018.1	1.87e-178	6	695	127	839
QOY86540.1	9.58e-148	9	702	145	829
QUT50058.1	1.04e-145	15	702	161	845
QBE96295.1	2.16e-136	6	696	126	814

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6I60_A	1.48e-79	12	695	173	879	Structureof alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12],6I60_B Structure of alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12]
6GSZ_A	2.21e-66	18	691	134	816	Crystalstructure of native alfa-L-rhamnosidase from Aspergillus terreus [Aspergillus terreus]
3W5M_A	1.08e-63	19	697	306	977	CrystalStructure of Streptomyces avermitilis alpha-L-rhamnosidase [Streptomyces avermitilis MA-4680 = NBRC 14893],3W5N_A Crystal Structure of Streptomyces avermitilis alpha-L-rhamnosidase complexed with L-rhamnose [Streptomyces avermitilis MA-4680 = NBRC 14893]
3CIH_A	3.02e-11	220	689	188	674	Crystalstructure of a putative alpha-rhamnosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KPL4	1.25e-78	7	702	177	893	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22170 PE=2 SV=1
Q82PP4	5.46e-63	19	697	306	977	Alpha-L-rhamnosidase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) OX=227882 GN=SAVERM_828 PE=1 SV=1
T2KNB2	3.62e-59	10	691	168	855	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22090 PE=1 SV=2
P9WF03	6.41e-57	19	691	174	855	Alpha-L-rhamnosidase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_34 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.996704	0.003286	0.000007	0.000004	0.000004	0.000007

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001615_04115.