CAZyme Information: MGYG000001615_05064

Basic Information

• Species: Eisenbergiella sp900548905
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Eisenbergiella; Eisenbergiella sp900548905
• CAZyme ID: MGYG000001615_05064
• CAZy Family: GH28
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
309		34270.54	6.704

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001615	6842156	MAG	China	Asia

• Gene Location: Start: 15562; End: 16491 Strand: +

Full Sequence      

MLLRKLELAEGKGKLGRAICLRRTDGVYLEGITVRQSPAWCVHLVYCNHVSLNGVHIHTK
YDEKENRYEGITNGDGLDPDSCSYVKVFNCTIASQDDCIAIKAGRNEEGRRVGIPSEHIR
ISNCTFLSGFGVAIGSEMSGGVRDVLVQDCTFRDVYSICSIKAPRGRGGMVEDITYDSIK
HCNHSREHQDCKWFRGAVYIDQFYSHDEYDWENSQPVDDGTSHIRNITLKNMEAETVTGN
AVFLAGLPESPLENIRLINVKAGGRYGMKAANIRNLQMENVTVGAREGGAYEYHAVSGKK
EGGEIRSNG

Enzyme Prediction     

No EC number prediction in MGYG000001615_05064.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH28	17	267	2.7e-55	0.6461538461538462

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG5434	Pgu1	1.10e-44	11	285	233	500	Polygalacturonase [Carbohydrate transport and metabolism].
pfam00295	Glyco_hydro_28	1.11e-21	11	285	80	319	Glycosyl hydrolases family 28. Glycosyl hydrolase family 28 includes polygalacturonase EC:3.2.1.15 as well as rhamnogalacturonase A(RGase A), EC:3.2.1.-. These enzymes are important in cell wall metabolism.
PLN03003	PLN03003	6.34e-17	10	210	132	307	Probable polygalacturonase At3g15720
PLN03010	PLN03010	4.76e-14	18	244	159	356	polygalacturonase
PLN02793	PLN02793	5.93e-11	73	261	226	393	Probable polygalacturonase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AIQ57019.1	4.77e-127	5	294	219	508
AIQ45845.1	8.53e-125	5	294	220	509
AEI40562.1	7.06e-123	7	296	178	467
AIQ51483.1	2.16e-122	5	293	220	508
AFC29187.1	2.67e-122	7	296	221	510

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3JUR_A	1.57e-28	23	299	197	444	Thecrystal structure of a hyperthermoactive Exopolygalacturonase from Thermotoga maritima [Thermotoga maritima],3JUR_B The crystal structure of a hyperthermoactive Exopolygalacturonase from Thermotoga maritima [Thermotoga maritima],3JUR_C The crystal structure of a hyperthermoactive Exopolygalacturonase from Thermotoga maritima [Thermotoga maritima],3JUR_D The crystal structure of a hyperthermoactive Exopolygalacturonase from Thermotoga maritima [Thermotoga maritima]
5OLP_A	1.92e-26	19	287	203	452	Galacturonidase[Bacteroides thetaiotaomicron VPI-5482],5OLP_B Galacturonidase [Bacteroides thetaiotaomicron VPI-5482]
6KVE_A	3.52e-12	25	240	117	299	ChainA, Endo-polygalacturonase [Evansstolkia leycettana]
6KVH_A	3.52e-12	25	240	117	299	ChainA, endo-polygalacturonase [Evansstolkia leycettana]
7E56_A	1.11e-11	25	180	109	250	ChainA, Endo-polygalacturonase [Evansstolkia leycettana]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A7PZL3	9.26e-25	27	260	210	422	Probable polygalacturonase OS=Vitis vinifera OX=29760 GN=GSVIVT00026920001 PE=1 SV=1
P27644	7.28e-21	11	251	12	249	Polygalacturonase OS=Rhizobium radiobacter OX=358 GN=pgl PE=2 SV=1
Q9LW07	1.04e-16	10	205	132	302	Probable polygalacturonase At3g15720 OS=Arabidopsis thaliana OX=3702 GN=At3g15720 PE=3 SV=1
Q9FY19	2.66e-13	18	260	186	399	Polygalacturonase OS=Juniperus ashei OX=13101 GN=JNA2 PE=1 SV=1
Q9P4W4	3.10e-10	25	240	141	323	Endopolygalacturonase A OS=Aspergillus niger OX=5061 GN=pgaA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000059	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001615_05064.