CAZyme Information: MGYG000001615_05364

Basic Information

• Species: Eisenbergiella sp900548905
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Eisenbergiella; Eisenbergiella sp900548905
• CAZyme ID: MGYG000001615_05364
• CAZy Family: GH151
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
684	MGYG000001615_71|CGC1	77158.5	6.3678

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001615	6842156	MAG	China	Asia

• Gene Location: Start: 19032; End: 21086 Strand: -

Full Sequence      

MKKQWWHDALRVIQYNLQIQDTGRMVPGEIAAKACEAGANAVVLNAGGIYAWYDSRIPFH
HINEYLPEGGLLEEVIRSCHEKGIRVIGRFDFSKTDDVVYLQHPEWFVKDREGKPVCYGS
GRMGNWSLLMSTCINGGYRNEAFAAKVMEEALANLDIDGIFFNAPHMEKCFCENCRRKYR
KLYGKELPARTEEWEPDWQTRCLRDNMTILYHTVKRRKEEIPVILYYGTYREDGTGLPEN
LDLRYETADMVCTEAQDILSAGKKNLPSSWKPSLNMKLGQCIPDVPRPFGIIHSCPGMDW
RHTGLPAAEYEFWLSQIPASNGQLWHSLTGFDAVIADKRLLETMKKVTHKAACSDRLMQE
ARSAAEVLLLWNAQASELGFVEGLMSCHIPFDIMDIWHLNPERLKAYKAVILPDGFPVNE
DSVGMLRAYVEAGGGLYAEKTDAGITESLSNLLGIRQEVCTGHDISAAYGALEPESVGLN
TNLTRTGYIPIKGELLYTVPQEGTAIRMTLVPPFAPPDGVGAPPERAGIPVKRTDIPLLL
ENRIGKGRVLTGFFELSRLMRQIGLEDQKQLFGNCISYLQGREKSFNAEKLPEGIFVYPY
RTDNKFLIHLVNGIGSRPLRDTIVCHQLEVEVSAGIWRNVGISRVYSALEGTHVSWKEKD
GRIRIQLESLRVWDIIVMESEGNL

Enzyme Prediction     

No EC number prediction in MGYG000001615_05364.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH151	35	163	1.8e-16	0.916030534351145

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam14871	GHL6	1.77e-34	27	163	2	134	Hypothetical glycosyl hydrolase 6. GHL6 is a family of hypothetical glycoside hydrolases.
cd03143	A4_beta-galactosidase_middle_domain	5.90e-05	364	438	24	85	A4 beta-galactosidase middle domain: a type 1 glutamine amidotransferase (GATase1)-like domain. A4 beta-galactosidase middle domain: a type 1 glutamine amidotransferase (GATase1)-like domain. This group includes proteins similar to beta-galactosidase from Thermus thermophilus. Beta-Galactosidase hydrolyzes the beta-1,4-D-galactosidic linkage of lactose, as well as those of related chromogens, o-nitrophenyl-beta-D-galactopyranoside (ONP-Gal) and 5-bromo-4-chloro-3-indolyl-beta-D-galactoside (X-gal). This A4 beta-galactosidase middle domain lacks the catalytic triad of typical GATase1 domains. The reactive Cys residue found in the sharp turn between a beta strand and an alpha helix termed the nucleophile elbow in typical GATase1 domains is not conserved in this group.
cd11313	AmyAc_arch_bac_AmyA	2.15e-04	72	159	78	162	Alpha amylase catalytic domain found in archaeal and bacterial Alpha-amylases (also called 1,4-alpha-D-glucan-4-glucanohydrolase). AmyA (EC 3.2.1.1) catalyzes the hydrolysis of alpha-(1,4) glycosidic linkages of glycogen, starch, related polysaccharides, and some oligosaccharides. This group includes firmicutes, bacteroidetes, and proteobacteria. The Alpha-amylase family comprises the largest family of glycoside hydrolases (GH), with the majority of enzymes acting on starch, glycogen, and related oligo- and polysaccharides. These proteins catalyze the transformation of alpha-1,4 and alpha-1,6 glucosidic linkages with retention of the anomeric center. The protein is described as having 3 domains: A, B, C. A is a (beta/alpha) 8-barrel; B is a loop between the beta 3 strand and alpha 3 helix of A; C is the C-terminal extension characterized by a Greek key. The majority of the enzymes have an active site cleft found between domains A and B where a triad of catalytic residues (Asp, Glu and Asp) performs catalysis. Other members of this family have lost the catalytic activity as in the case of the human 4F2hc, or only have 2 residues that serve as the catalytic nucleophile and the acid/base, such as Thermus A4 beta-galactosidase with 2 Glu residues (GH42) and human alpha-galactosidase with 2 Asp residues (GH31). The family members are quite extensive and include: alpha amylase, maltosyltransferase, cyclodextrin glycotransferase, maltogenic amylase, neopullulanase, isoamylase, 1,4-alpha-D-glucan maltotetrahydrolase, 4-alpha-glucotransferase, oligo-1,6-glucosidase, amylosucrase, sucrose phosphorylase, and amylomaltase.
cd14791	GH36	7.76e-04	29	160	23	148	glycosyl hydrolase family 36 (GH36). GH36 enzymes occur in prokaryotes, eukaryotes, and archaea with a wide range of hydrolytic activities, including alpha-galactosidase, alpha-N-acetylgalactosaminidase, stachyose synthase, and raffinose synthase. All GH36 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein. GH36 members are retaining enzymes that cleave their substrates via an acid/base-catalyzed, double-displacement mechanism involving a covalent glycosyl-enzyme intermediate. Two aspartic acid residues have been identified as the catalytic nucleophile and the acid/base, respectively.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QOT11974.1	1.30e-187	5	676	10	685
QHQ59610.1	1.55e-187	5	679	6	681
QIX92040.1	9.56e-181	1	629	1	638
QJP14423.1	2.94e-46	5	634	9	664
QGH35953.1	5.37e-43	5	679	3	665

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000082	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001615_05364.