CAZyme Information: MGYG000001615_05733

Basic Information

• Species: Eisenbergiella sp900548905
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Eisenbergiella; Eisenbergiella sp900548905
• CAZyme ID: MGYG000001615_05733
• CAZy Family: GH105
• CAZyme Description: Unsaturated rhamnogalacturonyl hydrolase YesR

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
377	MGYG000001615_95|CGC1	43659.84	4.6919

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001615	6842156	MAG	China	Asia

• Gene Location: Start: 3653; End: 4786 Strand: +

Full Sequence      

MLQEIDKKLQKLIDAFTGILYEDDDIFMENMRRKKNLSEEELRKYAHWEWTQGVGLYGIW
KLFEASGERKYLKMLTRYYDRQLQVGFPQCNVNTAAPFLTMSYLAEYLKDENYMKPCREA
AEWIMNGMPRTMEGGIQHMTSDDVNEQELWDDTLVMTVLFLANMGRILDREDYRNEAQYQ
FLLHMKYLQDPISGFWYHGWTFLERNHFAGAFWGRGNCWSTIAIPELLSMISCPEPVERI
LKEALCSQVEALSGCQADSGMWHTLLDDPESYEEASATCGFAYGILRGVHSGLLEEKWLA
AADRALNPILSLISEDGVLGQVSYGTPMGRESRDFYKEIPLKPMPYGQALAILFLVEWKR
GHKGSEQLLYTSKQEDI

Enzyme Prediction     

No EC number prediction in MGYG000001615_05733.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	41	360	7.9e-98	0.9819277108433735

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4225	YesR	7.15e-105	40	357	26	348	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].
pfam07470	Glyco_hydro_88	1.21e-94	24	360	3	341	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QEH70918.1	3.56e-159	3	357	4	357
QQR00386.1	3.23e-158	4	360	7	362
ANU44854.1	3.23e-158	4	360	7	362
BCJ96760.1	2.54e-157	4	357	8	360
QHQ59825.1	7.60e-155	5	358	9	361

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3QWT_A	8.19e-98	8	362	25	380	ChainA, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_B Chain B, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_C Chain C, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_D Chain D, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A]
3PMM_A	5.42e-96	8	360	26	379	ChainA, Putative cytoplasmic protein [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]
4XUV_A	4.90e-86	4	360	7	370	Crystalstructure of a glycoside hydrolase family 105 (GH105) enzyme from Thielavia terrestris [Thermothielavioides terrestris NRRL 8126],4XUV_B Crystal structure of a glycoside hydrolase family 105 (GH105) enzyme from Thielavia terrestris [Thermothielavioides terrestris NRRL 8126]
1NC5_A	6.10e-24	40	329	31	336	Structureof Protein of Unknown Function of YteR from Bacillus Subtilis [Bacillus subtilis],2D8L_A Crystal Structure of Unsaturated Rhamnogalacturonyl Hydrolase in complex with dGlcA-GalNAc [Bacillus subtilis]
2GH4_A	2.59e-23	40	329	21	326	ChainA, Putative glycosyl hydrolase yteR [Bacillus subtilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O31521	5.18e-65	48	357	29	334	Unsaturated rhamnogalacturonyl hydrolase YesR OS=Bacillus subtilis (strain 168) OX=224308 GN=yesR PE=1 SV=1
O34559	3.34e-23	40	329	31	336	Unsaturated rhamnogalacturonyl hydrolase YteR OS=Bacillus subtilis (strain 168) OX=224308 GN=yteR PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000049	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001615_05733.