CAZyme Information: MGYG000001615_05785

Basic Information

• Species: Eisenbergiella sp900548905
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Eisenbergiella; Eisenbergiella sp900548905
• CAZyme ID: MGYG000001615_05785
• CAZy Family: GH2
• CAZyme Description: Beta-galactosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
849	MGYG000001615_102|CGC1	98145.8	4.777

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001615	6842156	MAG	China	Asia

• Gene Location: Start: 3556; End: 6105 Strand: +

Full Sequence      

MTEKTLHTGWKMRRLGDMEWLPAAVPGSVYGDLLAAGRMEDPFWKDNEDKALALMEYDYE
YTMQFDCPEEILEKDRILLRFDGLDTIADVYLNGEHLGNADSMHRIWEYDSREQIKPTEN
ELKVVLHSPNQYIREAFRECRTLGNDDTLEGFVHIRKAHYMFGWDWGAHLPDAGIFRPVT
LLGIDRGRIDNVLILQEHERVLEADSDRAIAALGNRCVSRVRLQLQVTEETAGITDGVPK
QMDVTGGRVFGGCGQHMSYTAAVTAPDGTRVVYEDSPEEIIIEDPKLWWPNGYGAQDLYT
VKVILYSDGREIDSWEKRIGLRTMTMRRKKDEWGECFAHEVNGVAVFAMGADYIPEDNLL
GRVTPETTRKLLEKARFANFNAVRVWGGGYYPSDWFYDICDELGLMVWQDFMFACAVYEL
TPSFEANIRREFIENVKRIRHHASLGLWCGNNEMEQFVFERNSWLTKASEVRDYFLMFER
IIPEIVHTYDPQAFYWPASPSSGGCLDEPNDPDRGDVHYWAVWHGNKPFSEYRKYFFRYA
SEFGFQAFPSIKTIETFTDDPEDYNAFSYICEKHQRQYSANGKIMGYMQQTYKYPSGFDT
FIYASQLLQADAIRYGVEHFRRNRGRCMGAIYWQLNDCWPVVSWSSVDYTGRLKALHYYA
KRFFAPILLSCEEQGMMSAEANMNREHFEFEKSIRLNVANETMHEALVTVRWALRTPAAK
ICRSGEESLSVPALTSVWLDKILFPEADLRTNYVSYEMEMDGVILSEGTVNFSYPKYFAY
QDPGLTCEVDQDVITVKAQAYAKSVEIRNEADDLVLSDNFFDMNAGVRQIQILEGKADKL
SLRSVYDIK

Enzyme Prediction     

No EC number prediction in MGYG000001615_05785.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	4	736	1.1e-99	0.6821808510638298

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3250	LacZ	1.84e-101	22	670	27	635	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
PRK10340	ebgA	5.50e-11	61	453	113	449	cryptic beta-D-galactosidase subunit alpha; Reviewed
pfam00703	Glyco_hydro_2	1.26e-10	260	322	47	106	Glycosyl hydrolases family 2. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.
pfam17786	Mannosidase_ig	7.76e-09	694	777	3	91	Mannosidase Ig/CBM-like domain. This domain corresponds to domain 4 in the structure of Bacteroides thetaiotaomicron beta-mannosidase, BtMan2A. This domain has an Ig-like fold.
pfam17753	Ig_mannosidase	3.66e-08	782	847	1	78	Ig-fold domain. This Ig-like fold domain is found in mannosidase enzymes.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QJU13790.1	0.0	1	849	1	823
QQQ93614.1	0.0	1	849	1	823
ASU28856.1	0.0	1	849	1	823
ANU76049.1	0.0	1	849	1	823
QBE97789.1	0.0	1	849	15	837

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6BYE_A	6.33e-155	1	849	3	848	Crystalstructure of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri in complex with mannose [Xanthomonas citri pv. citri str. 306],6BYE_B Crystal structure of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri in complex with mannose [Xanthomonas citri pv. citri str. 306]
6BYC_A	6.50e-155	1	849	3	848	Crystalstructure of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri [Xanthomonas citri pv. citri str. 306]
6BYI_A	4.64e-154	1	849	1	846	Crystalstructure of the acid-base mutant (E477A) of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri [Xanthomonas citri pv. citri str. 306],6BYI_B Crystal structure of the acid-base mutant (E477A) of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri [Xanthomonas citri pv. citri str. 306]
6BYG_A	4.77e-154	1	849	3	848	Crystalstructure of the nucleophile mutant (E575A) of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri [Xanthomonas citri pv. citri str. 306],6BYG_B Crystal structure of the nucleophile mutant (E575A) of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri [Xanthomonas citri pv. citri str. 306]
2VJX_A	4.13e-147	6	833	11	816	Structuraland biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VJX_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VL4_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VL4_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VMF_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VMF_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VO5_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VO5_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VOT_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VOT_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VQT_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VQT_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VR4_A Transition-state mimicry in mannoside hydrolysis: characterisation of twenty six inhibitors and insight into binding from linear free energy relationships and 3-D structure [Bacteroides thetaiotaomicron VPI-5482],2VR4_B Transition-state mimicry in mannoside hydrolysis: characterisation of twenty six inhibitors and insight into binding from linear free energy relationships and 3-D structure [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q0CCA0	6.24e-111	3	846	6	840	Beta-mannosidase B OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=mndB PE=3 SV=2
Q5B7W2	3.73e-106	2	835	5	828	Beta-mannosidase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=mndB PE=1 SV=2
A2QYN2	2.06e-104	5	839	8	835	Beta-mannosidase B OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=mndB PE=3 SV=1
A1CGA8	1.54e-103	6	835	9	830	Beta-mannosidase B OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=mndB PE=3 SV=1
A1D911	1.54e-103	6	835	9	830	Beta-mannosidase B OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=mndB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000075	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001615_05785.