CAZyme Information: MGYG000001616_00101

Basic Information

• Species: Dysosmobacter sp900544955
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Oscillospiraceae; Dysosmobacter; Dysosmobacter sp900544955
• CAZyme ID: MGYG000001616_00101
• CAZy Family: GH18
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
550		59101.66	4.6213

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001616	2795503	MAG	China	Asia

• Gene Location: Start: 95479; End: 97131 Strand: +

Full Sequence      

MKKLLSCLTALALTAVLAVPMAGAYSDIPAGGALSEEVWKAVDYGLMNGYAPNTFGYTDS
MTRAQFVTVVGRMLGWFEGAQTAEAHITSAMQVPQDISVTYWNAISAAAKYDVVDTDRAF
RPGEAVTRGEMAEILVRALGLKPAAAIAEKESDLPFSDVAQRKGYIAVAYAVGMTKGTSA
TTYAPDATATRAQAAAMLVRIYEKIHQAAGFVHGFYALSSYSQLDLAGQMDAVSAGWSRM
TWDGTTALLSTTGANSNEYYVPTGYQEVTDYMSDHQVDFHLSVFMEAGGGLRELLASADG
RSQAVEQIVNELTVTYQGIGQNPYSGVTIDFEGLRSAQRADFTAFLTELSAAVDKLDKSL
YVCVSPALTGGAYYDGYDYRAIGDLADKVILMAYDYEARDAAIYLGTAVASSQGFAEATK
NAPAGQVFWSLLAITDSRTGVRDPEKVLLGVSSKNVAWEVDGEGRLVSAKPVYLANDAAY
QYIQQGTAGRNGAYAVFTAGDGKRYFLWLEDPLVNLRSAKLLGVTGVSLWRLGTLPMYDG
WSWQSLLRTA

Enzyme Prediction     

No EC number prediction in MGYG000001616_00101.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH18	252	533	4.3e-22	0.777027027027027

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd02874	GH18_CFLE_spore_hydrolase	4.24e-21	212	546	4	313	Cortical fragment-lytic enzyme (CFLE) is a peptidoglycan hydrolase involved in bacterial endospore germination. CFLE is expressed as an inactive preprotein (called SleB) in the forespore compartment of sporulating cells. SleB translocates across the forespore inner membrane and is deposited as a mature enzyme in the cortex layer of the spore. As part of a sensory mechanism capable of initiating germination, CFLE degrades a spore-specific peptidoglycan constituent called muramic-acid delta-lactam that comprises the outer cortex. CFLE has a C-terminal glycosyl hydrolase family 18 (GH18) catalytic domain as well as two N-terminal LysM peptidoglycan-binding domains. In addition to SleB, this family includes YaaH, YdhD, and YvbX from Bacillus subtilis.
COG3858	YaaH	2.42e-16	324	533	208	408	Spore germination protein YaaH [Cell cycle control, cell division, chromosome partitioning].
cd06549	GH18_trifunctional	1.35e-11	288	535	76	293	GH18 domain of an uncharacterized family of bacterial proteins, which share a common three-domain architecture: an N-terminal glycosyl hydrolase family 18 (GH18) domain, a glycosyl transferase family 2 domain, and a C-terminal polysaccharide deacetylase domain.
cd00598	GH18_chitinase-like	2.21e-09	281	395	69	177	The GH18 (glycosyl hydrolase, family 18) type II chitinases hydrolyze chitin, an abundant polymer of beta-1,4-linked N-acetylglucosamine (GlcNAc) which is a major component of the cell wall of fungi and the exoskeleton of arthropods. Chitinases have been identified in viruses, bacteria, fungi, protozoan parasites, insects, and plants. The structure of the GH18 domain is an eight-stranded beta/alpha barrel with a pronounced active-site cleft at the C-terminal end of the beta-barrel. The GH18 family includes chitotriosidase, chitobiase, hevamine, zymocin-alpha, narbonin, SI-CLP (stabilin-1 interacting chitinase-like protein), IDGF (imaginal disc growth factor), CFLE (cortical fragment-lytic enzyme) spore hydrolase, the type III and type V plant chitinases, the endo-beta-N-acetylglucosaminidases, and the chitolectins. The GH85 (glycosyl hydrolase, family 85) ENGases (endo-beta-N-acetylglucosaminidases) are closely related to the GH18 chitinases and are included in this alignment model.
NF033190	inl_like_NEAT_1	1.07e-06	25	186	582	736	NEAT domain-containing leucine-rich repeat protein. Members of this family have an N-terminal NEAT (near transporter) domain often associated with iron transport, followed by a leucine-rich repeat region with significant sequence similarity to the internalins of Listeria monocytogenes. However, since Bacillus cereus (from which this protein was described, in PMID:16978259) is not considered an intracellular pathogen, and the function may be iron transport rather than internalization, applying the name "internalin" to this family probably would be misleading.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUO37985.1	1.28e-206	1	547	1	551
BAK99492.1	1.58e-204	1	547	21	569
QNL45580.1	3.12e-183	2	543	3	546
QAT42616.1	2.39e-136	25	542	34	548
QIB69198.1	4.78e-136	25	542	34	548

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3CZ8_A	4.80e-07	285	396	76	185	ChainA, Putative sporulation-specific glycosylase ydhD [Bacillus subtilis subsp. subtilis str. 168],3CZ8_B Chain B, Putative sporulation-specific glycosylase ydhD [Bacillus subtilis subsp. subtilis str. 168]
4Q6T_A	3.99e-06	324	395	114	187	Thecrystal structure of a class V chitininase from Pseudomonas fluorescens Pf-5 [Pseudomonas protegens Pf-5]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P38538	7.78e-09	1	143	31	175	Surface layer protein OS=Brevibacillus choshinensis OX=54911 PE=1 SV=1
P06546	3.61e-07	1	143	1	147	Middle cell wall protein OS=Brevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599) OX=358681 GN=BBR47_54160 PE=4 SV=4
O05495	2.08e-06	285	542	168	405	Putative sporulation-specific glycosylase YdhD OS=Bacillus subtilis (strain 168) OX=224308 GN=ydhD PE=1 SV=2
P37531	2.13e-06	307	533	195	409	Cortical fragment-lytic enzyme OS=Bacillus subtilis (strain 168) OX=224308 GN=sleL PE=1 SV=2
P38535	4.31e-06	46	204	928	1083	Exoglucanase XynX OS=Acetivibrio thermocellus OX=1515 GN=xynX PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000370	0.998775	0.000198	0.000241	0.000214	0.000188

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001616_00101.