CAZyme Information: MGYG000001616_02108

Basic Information

• Species: Dysosmobacter sp900544955
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Oscillospiraceae; Dysosmobacter; Dysosmobacter sp900544955
• CAZyme ID: MGYG000001616_02108
• CAZy Family: GH25
• CAZyme Description: Cell division suppressor protein YneA

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
429	MGYG000001616_38|CGC1	45761.57	5.2784

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001616	2795503	MAG	China	Asia

• Gene Location: Start: 10907; End: 12196 Strand: +

Full Sequence      

MKHRCALTALVLLLTLAAPARALGPAPAAPVYEGADISVYQGHVDFQRLAEGGVEIVYIR
AGFGETEDARFRENAAGAAEAGLRRGFYYYVTARTAEAARAQARHFAGLLAQQRYDCRPA
MDFEAFDGLSARQVRAVGLAFLEVLEAETGQVPLLYADAWAASALWSTEAFARYPLWAAA
YGAAEPEVENSVWPGWAGFQYTDQGVLPGISGAVDRDRFTAAVTLAEAPAERTYTVQPGD
TLWGIAERYGTTVSALAAANGIRNPSLIYPGQVLRIPGGTAERTYTVQPGDTLWGIAERY
GTTVSALAAANGIRNPSLIYPGQVLRIPGGTAERTYTVQPGDTLWGIAERYGTTVSALAA
ANGIRNPSLIYPGQVLRIPGGTAERTYTVQPGDTLWGIAERYGTTVSALAAANGIRNPDL
IYPGQVLRI

Enzyme Prediction     

No EC number prediction in MGYG000001616_02108.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH25	36	210	9.4e-40	0.9887005649717514
CBM50	234	277	3.3e-19	0.975
CBM50	285	328	3.3e-19	0.975
CBM50	336	379	3.3e-19	0.975
CBM50	387	429	2.3e-18	0.95

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK06347	PRK06347	2.91e-40	232	429	331	591	1,4-beta-N-acetylmuramoylhydrolase.
cd06525	GH25_Lyc-like	2.53e-36	34	219	2	184	Lyc muramidase is an autolytic lysozyme (autolysin) from Clostridium acetobutylicum encoded by the lyc gene. Lyc has a glycosyl hydrolase family 25 (GH25) catalytic domain. Endo-N-acetylmuramidases are lysozymes (also referred to as peptidoglycan hydrolases) that degrade bacterial cell walls by catalyzing the hydrolysis of 1,4-beta-linkages between N-acetylmuramic acid and N-acetyl-D-glucosamine residues.
cd00599	GH25_muramidase	4.93e-27	34	219	2	186	Endo-N-acetylmuramidases (muramidases) are lysozymes (also referred to as peptidoglycan hydrolases) that degrade bacterial cell walls by catalyzing the hydrolysis of 1,4-beta-linkages between N-acetylmuramic acid and N-acetyl-D-glucosamine residues. This family of muramidases contains a glycosyl hydrolase family 25 (GH25) catalytic domain and is found in bacteria, fungi, slime molds, round worms, protozoans and bacteriophages. The bacteriophage members are referred to as endolysins which are involved in lysing the host cell at the end of the replication cycle to allow release of mature phage particles. Endolysins are typically modular enzymes consisting of a catalytically active domain that hydrolyzes the peptidoglycan cell wall and a cell wall-binding domain that anchors the protein to the cell wall. Endolysins generally have narrow substrate specificities with either intra-species or intra-genus bacteriolytic activity.
pfam01183	Glyco_hydro_25	7.52e-26	36	210	2	180	Glycosyl hydrolases family 25.
cd06524	GH25_YegX-like	4.32e-23	34	219	2	192	YegX is an uncharacterized bacterial protein with a glycosyl hydrolase family 25 (GH25) catalytic domain that is similar in sequence to the CH-type (Chalaropsis-type) lysozymes of the GH25 family of endolysins.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QJS18123.1	1.96e-123	21	427	21	448
QWT55024.1	5.79e-119	31	429	35	465
QBB65008.1	4.07e-106	14	329	13	331
ALP93086.1	1.63e-105	14	329	13	331
QIB56830.1	1.93e-100	32	378	34	402

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4KRU_A	3.85e-26	33	223	21	211	X-raystructure of catalytic domain of endolysin from clostridium perfringens phage phiSM101 [Clostridium phage phiSM101]
4KRT_A	4.04e-25	33	223	21	211	X-raystructure of endolysin from clostridium perfringens phage phiSM101 [Clostridium phage phiSM101],4KRT_B X-ray structure of endolysin from clostridium perfringens phage phiSM101 [Clostridium phage phiSM101]
1JFX_A	6.42e-13	33	233	6	216	Crystalstructure of the bacterial lysozyme from Streptomyces coelicolor at 1.65 A resolution [Streptomyces coelicolor]
4UZ2_A	1.09e-09	333	386	2	52	Crystalstructure of the N-terminal LysM domains from the putative NlpC/P60 D,L endopeptidase from T. thermophilus [Thermus thermophilus HB8],4UZ2_B Crystal structure of the N-terminal LysM domains from the putative NlpC/P60 D,L endopeptidase from T. thermophilus [Thermus thermophilus HB8],4UZ2_C Crystal structure of the N-terminal LysM domains from the putative NlpC/P60 D,L endopeptidase from T. thermophilus [Thermus thermophilus HB8],4UZ2_D Crystal structure of the N-terminal LysM domains from the putative NlpC/P60 D,L endopeptidase from T. thermophilus [Thermus thermophilus HB8],4UZ3_A Crystal structure of the N-terminal LysM domains from the putative NlpC/P60 D,L endopeptidase from T. thermophilus bound to N-acetyl-chitohexaose [Thermus thermophilus HB8],4UZ3_B Crystal structure of the N-terminal LysM domains from the putative NlpC/P60 D,L endopeptidase from T. thermophilus bound to N-acetyl-chitohexaose [Thermus thermophilus HB8],4UZ3_C Crystal structure of the N-terminal LysM domains from the putative NlpC/P60 D,L endopeptidase from T. thermophilus bound to N-acetyl-chitohexaose [Thermus thermophilus HB8]
4B8V_A	2.60e-09	284	379	116	217	ChainA, Extracellular Protein 6 [Fulvia fulva],4B9H_A Chain A, Extracellular Protein 6 [Fulvia fulva]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P39046	3.62e-34	233	427	413	662	Muramidase-2 OS=Enterococcus hirae (strain ATCC 9790 / DSM 20160 / JCM 8729 / LMG 6399 / NBRC 3181 / NCIMB 6459 / NCDO 1258 / NCTC 12367 / WDCM 00089 / R) OX=768486 GN=EHR_05900 PE=1 SV=1
O31852	2.87e-31	224	429	18	268	D-gamma-glutamyl-meso-diaminopimelic acid endopeptidase CwlS OS=Bacillus subtilis (strain 168) OX=224308 GN=cwlS PE=1 SV=1
Q8CMN2	3.95e-30	221	381	16	193	N-acetylmuramoyl-L-alanine amidase sle1 OS=Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200) OX=176280 GN=sle1 PE=3 SV=1
Q5HRU2	3.95e-30	221	381	16	193	N-acetylmuramoyl-L-alanine amidase sle1 OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) OX=176279 GN=sle1 PE=3 SV=1
Q49UX4	5.78e-30	221	380	16	195	N-acetylmuramoyl-L-alanine amidase sle1 OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41) OX=342451 GN=sle1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000307	0.998917	0.000232	0.000184	0.000175	0.000165

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001616_02108.