CAZyme Information: MGYG000001617_00311

Basic Information

• Species: Clostridium_Q sp900547735
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Clostridium_Q; Clostridium_Q sp900547735
• CAZyme ID: MGYG000001617_00311
• CAZy Family: GT32
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
257	MGYG000001617_3|CGC2	30286.89	8.1173

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001617	5446084	MAG	China	Asia

• Gene Location: Start: 54229; End: 55002 Strand: +

Full Sequence      

MSIPKIIHYCWFGPNPIPDMEKKCIQSWKQHLPDYEIIFWNEATFDVKSVDYVKQAYSCG
KYAFVSDYVRINALYRFGGIYLDTDVEVLRNLDEFLENEAFIGFENRTMVGTGIIGAEKN
NAILGAMLDYYHANPFINEKGYMDMTTNVKILYKLLVLNGFESEDREQRLKGIHIYKREY
FCPKRIGKNEFKVTEHSAVIHHFSGSWLSEKEKKRGNSLIWRNVFRPLLRKTREILLTIL
DEDTVKNLEAELRNKMR

Enzyme Prediction     

No EC number prediction in MGYG000001617_00311.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	21	98	1.5e-24	0.9555555555555556

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3774	OCH1	1.11e-22	3	134	82	217	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
pfam04488	Gly_transf_sug	7.03e-17	18	101	1	92	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.
pfam05704	Caps_synth	1.21e-14	3	133	46	190	Capsular polysaccharide synthesis protein. This family consists of several capsular polysaccharide proteins. Capsular polysaccharide (CPS) is a major virulence factor in Streptococcus pneumoniae.
pfam12919	TcdA_TcdB	0.003	41	85	148	193	TcdA/TcdB catalytic glycosyltransferase domain. This domain represents the N-terminal glycosyltransferase from a set of toxins found in some bacteria. This domain in TcdB glycosylates the host RhoA protein.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QDH23613.1	1.60e-80	3	236	28	269
QYR65866.1	1.51e-72	3	229	2	221
AST58537.1	9.75e-72	3	213	5	215
AVX19941.1	2.40e-70	2	213	3	216
AXE20522.1	3.86e-70	3	215	2	214

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q10323	1.02e-08	2	124	56	181	Inositol phosphoceramide mannosyltransferase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC17G8.11c PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000016	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001617_00311.