CAZyme Information: MGYG000001617_01540

Basic Information

• Species: Clostridium_Q sp900547735
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Clostridium_Q; Clostridium_Q sp900547735
• CAZyme ID: MGYG000001617_01540
• CAZy Family: GH3
• CAZyme Description: Thermostable beta-glucosidase B

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
840	MGYG000001617_16|CGC1	91982.3	5.359

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001617	5446084	MAG	China	Asia

• Gene Location: Start: 29216; End: 31738 Strand: +

Full Sequence      

MKHMDIIEKMTVEEKAAFLSGKNEWQSRDIPHLGIPSIFCADGPHGVRKQAGEGDHLGLN
PSLPATCFPTAATVANSWDEELGEELGRTLGAEAAALGVNVLLGPGLNMKRSPLCGRNFE
YFSEDPYQAGKMAASYIRGIQSQGVAACPKHFAVNSQELRRMAMNAVIDERTLREIYLTG
FEIAVKEGGAKALMTSYNEINGTYANENEHLLKDILRGEWGFDGMVVTDWGGSNDHVRGV
ACRSNLEMPTPGLDSARQLLKALDEGRLTMEELDTCVDDLLDAVLTLTENGRDGAGAEEG
KETKSEEKSDGETAGTADRKSGKSAAGFDAAAHNAIAWKAAAESIVLLKNVPDPEPLLPL
KKSCSVALVGDFAIRPRYQGAGSSLVNPIMEIATMETMISGYPLVNAGCAAGYRRTGEAD
EALKKEALDLAQNADVVIYCFGLNEISESEGMDRSHMRIPQNQIELLEALVKVNSNIVGV
LSGGSAVEMSWHHCCRSIVHGYLGGQAGAGAMLDVLTGKVNPSGRLAETYPVRYEDTPAF
RFFPSTERNSEYRESLYIGYRYYDTARVRVQYPFGYGLSYTSFAYSGLTVTETGVTFCLE
NTGECDGAEVAQLYVGCWDGAVFRPEKELKGFKKVFLKRGEKKQVSIPFDDKTFRYWNVA
TNRWETEAGTYQILVGACVLDIRLSGSITRTGTTDRLPYEGLELPSYRTGFIQNVDREEY
EKLLGHPLPSGKWMGELGLNDAVCQMYYAKSGLARLIYKVLTDKKNKNEAAGTPDLNLLF
QYNIPFRAIAKMTGGMVSMEMAEGAVTVVNGHFFRGIGRIIAGFFRNLKANKQYEKKLGN

Enzyme Prediction     

EC	3.2.1.21	3.2.1.-	3.2.1.45

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	30	237	1.5e-69	0.8981481481481481

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK15098	PRK15098	1.17e-78	33	676	102	751	beta-glucosidase BglX.
COG1472	BglX	1.15e-67	30	373	55	364	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
PLN03080	PLN03080	2.22e-55	6	650	56	743	Probable beta-xylosidase; Provisional
pfam01915	Glyco_hydro_3_C	2.52e-51	345	580	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
pfam00933	Glyco_hydro_3	8.21e-41	19	281	48	314	Glycosyl hydrolase family 3 N terminal domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QJU18245.1	0.0	1	838	1	808
QRT31068.1	0.0	1	839	1	808
QBE98345.1	0.0	1	840	1	806
QEI32524.1	0.0	1	839	1	808
QHB25014.1	0.0	1	839	1	808

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7MS2_A	2.03e-199	6	693	8	671	ChainA, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
5WAB_A	6.35e-169	7	700	9	673	CrystalStructure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_B Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_C Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_D Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703]
2X40_A	1.12e-120	5	689	6	712	Structureof beta-glucosidase 3B from Thermotoga neapolitana in complex with glycerol [Thermotoga neapolitana DSM 4359],2X41_A Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glucose [Thermotoga neapolitana DSM 4359]
2X42_A	1.67e-119	5	689	6	712	Structureof beta-glucosidase 3B from Thermotoga neapolitana in complex with alpha-D-glucose [Thermotoga neapolitana DSM 4359]
3AC0_A	3.47e-98	6	682	9	828	Crystalstructure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_B Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_C Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_D Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P14002	1.11e-198	6	693	8	671	Thermostable beta-glucosidase B OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=bglB PE=1 SV=2
E7CY69	2.04e-158	7	682	9	664	Exo-alpha-(1->6)-L-arabinopyranosidase OS=Bifidobacterium longum OX=216816 GN=apy PE=1 SV=1
F6C6C1	5.72e-158	7	692	9	674	Exo-alpha-(1->6)-L-arabinopyranosidase OS=Bifidobacterium breve (strain ACS-071-V-Sch8b) OX=866777 GN=HMPREF9228_1477 PE=1 SV=1
A7LXS8	4.10e-131	5	689	48	742	Beta-glucosidase BoGH3A OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02644 PE=1 SV=1
P27034	3.91e-111	5	688	4	808	Beta-glucosidase OS=Rhizobium radiobacter OX=358 GN=cbg-1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000022	0.000029	0.000001	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001617_01540.