CAZyme Information: MGYG000001618_00187

Basic Information

• Species: Peptostreptococcus russellii
• Lineage: Bacteria; Firmicutes_A; Clostridia; Peptostreptococcales; Peptostreptococcaceae; Peptostreptococcus; Peptostreptococcus russellii
• CAZyme ID: MGYG000001618_00187
• CAZy Family: GH73
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
248	MGYG000001618_1|CGC3	29030.11	10.1707

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001618	1945578	MAG	China	Asia

• Gene Location: Start: 237919; End: 238665 Strand: +

Full Sequence      

MDICIEKRSLFSEEEIINNINRNNTLYRSGKVSKSKKRSKRKRKRKRNKKRKKWPMLILI
LFFIFAYGTVTNIRNSNNLMIDKNNIDKEEFISRVEKVAVSEYEKSGILPSITISQAILE
SSWGNSRLSMEGNNLFGIKADKSWSGEKINFTTEEYKDNYEKADFRKYNSWEDSIKDHSK
FLMENKRYLNSGLFNSKGYKEQAKALEDAGYATTIDSAGNKIYAEKLIRVIESYKLYEID
NKVINKSE

Enzyme Prediction     

No EC number prediction in MGYG000001618_00187.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH73	98	236	3.1e-38	0.96875

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1705	FlgJ	1.19e-50	57	241	7	189	Flagellum-specific peptidoglycan hydrolase FlgJ [Cell wall/membrane/envelope biogenesis, Cell motility].
PRK05684	flgJ	1.62e-36	87	235	151	298	flagellar assembly peptidoglycan hydrolase FlgJ.
smart00047	LYZ2	1.68e-26	85	236	5	141	Lysozyme subfamily 2. Eubacterial enzymes distantly related to eukaryotic lysozymes.
pfam01832	Glucosaminidase	2.41e-26	97	236	2	91	Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase. This family includes Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase EC:3.2.1.96. As well as the flageller protein J that has been shown to hydrolyze peptidoglycan.
NF038016	sporang_Gsm	3.47e-25	89	240	161	312	sporangiospore maturation cell wall hydrolase GsmA. The peptidoglycan-hydrolyzing enzyme GsmA occurs in some sporangia-forming members of the Actinobacteria, such as Actinoplanes missouriensis, and is required for proper separation of spores. GsmA proteins have one or two SH3 domains N-terminal to the hydrolase domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QPK99332.1	2.50e-53	87	246	165	324
AXB63823.1	4.98e-53	87	246	165	324
AXU85881.1	4.98e-53	87	246	165	324
ASN88737.1	4.98e-53	87	246	165	324
AXU52788.1	4.98e-53	87	246	165	324

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5T1Q_A	2.50e-11	87	242	59	214	ChainA, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_B Chain B, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_C Chain C, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_D Chain D, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O32083	6.73e-23	86	240	45	198	Exo-glucosaminidase LytG OS=Bacillus subtilis (strain 168) OX=224308 GN=lytG PE=1 SV=1
Q9X9J3	6.48e-18	89	230	161	301	Peptidoglycan hydrolase FlgJ OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) OX=223926 GN=flgJ PE=3 SV=1
Q9KQ15	1.62e-17	88	238	161	313	Peptidoglycan hydrolase FlgJ OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) OX=243277 GN=flgJ PE=3 SV=2
P0C2T5	9.86e-13	89	240	63	214	Probable N-acetylmuramidase OS=Lactococcus lactis subsp. cremoris OX=1359 GN=acmA PE=3 SV=1
A2RHZ5	1.80e-12	89	240	63	214	Probable N-acetylmuramidase OS=Lactococcus lactis subsp. cremoris (strain MG1363) OX=416870 GN=acmA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999950	0.000067	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
54	73