CAZyme Information: MGYG000001619_00591

Basic Information

• Species: UBA9502 sp900540335
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; UBA9502; UBA9502 sp900540335
• CAZyme ID: MGYG000001619_00591
• CAZy Family: CE8
• CAZyme Description: Pectinesterase A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
352		39183.98	5.246

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001619	2970880	MAG	China	Asia

• Gene Location: Start: 73644; End: 74702 Strand: -

Full Sequence      

MNQNIQKEYHISPDGSGDFSSLFEALSALQDTKFPEETNLAENLPAYPDFRTSGGDAEPV
VLFLHSGIYRERIVIVRPGITIIGDDPQTTVITGGLYARMPMEDIGKRGTFRTFSCLIAS
HDITFKNVTFENSSGKGPDVGQALALYADGDRLVFDNCRFLGNQDTLFTAPLPPKEIEPN
GFVGPGQKLPRAFGRHYYKNCYLEGDIDFIFGGAAAYFENCELFSKNINRPVNSYVTAAS
TPQGQPYGYVMKNCRFTGNCPPHSAYLGRPWREYAKTVLLNCYIGEHICEEGWHDWNKEE
AHEHALYAEYESTGPSSDMKKRPGWVKSLTPAEAALYVKSLVLKGNDGWDPA

Enzyme Prediction     

No EC number prediction in MGYG000001619_00591.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE8	11	344	1.1e-85	0.9826388888888888

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4677	PemB	1.04e-73	59	346	112	405	Pectin methylesterase and related acyl-CoA thioesterases [Carbohydrate transport and metabolism, Lipid transport and metabolism].
pfam01095	Pectinesterase	3.78e-65	11	346	4	298	Pectinesterase.
PLN02773	PLN02773	3.04e-57	11	338	9	291	pectinesterase
PLN02990	PLN02990	2.52e-55	11	351	263	561	Probable pectinesterase/pectinesterase inhibitor
PLN02432	PLN02432	7.54e-53	56	349	37	291	putative pectinesterase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SET76962.1	1.96e-156	10	351	3	321
QRP39805.1	5.25e-128	11	351	20	349
ASN95501.1	5.25e-128	11	351	20	349
QIX89293.1	2.36e-126	11	351	19	348
ANU50094.1	4.75e-126	11	351	19	348

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1XG2_A	1.55e-33	11	346	7	301	ChainA, Pectinesterase 1 [Solanum lycopersicum]
1GQ8_A	8.21e-28	11	325	11	281	Pectinmethylesterase from Carrot [Daucus carota]
2NSP_A	4.24e-26	59	351	34	339	ChainA, Pectinesterase A [Dickeya dadantii 3937],2NSP_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NST_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NST_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT6_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT6_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT9_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT9_B Chain B, Pectinesterase A [Dickeya dadantii 3937]
5C1C_A	5.22e-25	54	322	30	271	CrystalStructure of the Pectin Methylesterase from Aspergillus niger in Deglycosylated Form [Aspergillus niger ATCC 1015]
5C1E_A	5.22e-25	54	322	30	271	CrystalStructure of the Pectin Methylesterase from Aspergillus niger in Penultimately Deglycosylated Form (N-acetylglucosamine Stub at Asn84) [Aspergillus niger ATCC 1015]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8GXA1	5.94e-47	11	351	260	558	Probable pectinesterase/pectinesterase inhibitor 23 OS=Arabidopsis thaliana OX=3702 GN=PME23 PE=2 SV=3
Q9LVQ0	9.73e-45	11	338	9	291	Pectinesterase 31 OS=Arabidopsis thaliana OX=3702 GN=PME31 PE=1 SV=1
Q9FJ21	4.19e-43	11	346	262	556	Probable pectinesterase/pectinesterase inhibitor 58 OS=Arabidopsis thaliana OX=3702 GN=PME58 PE=2 SV=1
Q9LXD9	1.12e-40	61	337	271	535	Probable pectinesterase/pectinesterase inhibitor 51 OS=Arabidopsis thaliana OX=3702 GN=PME51 PE=2 SV=1
Q43043	3.15e-40	4	349	54	359	Pectinesterase OS=Petunia integrifolia OX=4103 GN=PPE1 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000044	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001619_00591.