CAZyme Information: MGYG000001619_02587

Basic Information

• Species: UBA9502 sp900540335
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; UBA9502; UBA9502 sp900540335
• CAZyme ID: MGYG000001619_02587
• CAZy Family: PL8
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1931		210745.76	4.1743

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001619	2970880	MAG	China	Asia

• Gene Location: Start: 6515; End: 12310 Strand: -

Full Sequence      

MNVKNTVETESYQAELNLSDGGMVFKNKVRGEKSWNTADTAMIPGATMFLEGDNSARKAD
MTAANVLNSMDADGGAAGMQMSGELSGVKSWFFFDNEILCLGADIANTGDTTDKIINVVD
NVTVEKTTYAGLTNPANGYRNILKASVDTNEKYSWKKIVDTATKGSHARNWLTASGIEDS
QKSLEWSYVFGDTITNSKVFYRFPTEGTGEVKQFELWTLPVNGGYQYTLGAGKKQGDFAN
NAPAETENRVLENTGAIQAAENESEGTLAVNKWTDGEVNLKGKVAEVALNEAASVVIEKN
GAAGKALITVAKPESGASSQITLSAALDAESAKELGSLGAAEVTTDGGTVTMKLDTAKMS
SPVSVEVQLKKIDVVTGETITLVRGDEVKLETPEELTGNVTWSTKFLKYDGTYLRNVGSS
KKKRELKEGETDGTRKAGDATADHLLSVTGVQDGAILNAKNKGEMVVVAADESGKSKQWK
VKVLHEDPANLPEAGPEDYAKIRTAWKESLIGTNLTEEDGGQEILDIINAEAEGYWNAYA
YKGQETCEDVPWKGDIGGGKENPDVPYEDDAVEFRPAFQKVLSMCKAYASEGGKLYHNQD
MLKDIIHILDYMCTRCYVPKSQTDNWWTWEIGMPKDLIPALILIYDELSEEQIMKYTEAL
YFFQPDPYWEGAINTASTHVKGYRAAQGANIIDCSTTAVGLGALREDNELVYLGMMASSQ
TFVIQQVEDSTKLAEEGFKSGFYPDGSYMDHGRLAYLGSYGVEFMKGGVKIPSLIGGTPW
QYPEEVQKNLEYYIVEGFGNGIYRGMMLDCLKGRSVARPGGSNRAAGREAMICILQMVDS
LSAEARATTLPMLKSWLEEDEGFIDSLQGAENMAIKKKAREILEDSSIEGYVAPVHKSYP
LMDRAFHRMDDYLFAVSMFSERTQNTEIMNDENRFGWHQNDGMTYIYDRDDMYTENFWNT
VNPLRLPGTTVAAMKIDNGAPDSSGFIQKGDFLSTESWVGGSSIGNYGISGMAFSGKIKG
AEGDASTTYAPELNGKKSWFMFDDEIVCLGADINNKNMNVPVETTIDNRKLDQDGSNGFL
VDGQEMDLPVKEANVKELADRSVDVSGVACEDIRWAHVEGTESAGTGYYFPEENTEIQVR
RAKTTGSWRDIGTFDGESTENYLEMWFDHGENPAGASYSYVLLPETDAGETEAYAAAPEI
AVLANNKEAQAVYHKGLNITGINFWNKNGGSVNDVTSSSAASVMLQESETGLLTVAVSDP
TMKNQGTIQITIRKPIASEEKLDENVSCEQMEDGSVVLTFQMKGTNGASSMAELQLQASV
YPAAVRLENGESQQFEVRDYGMGIQETSWSVSGTEQELAEGTAVDEDGVLQIDEEEANTA
LVVTAETDAGVIFHAYVSLGSPASAELPQEIQELKTLAGNALKAAEENGADSEEAREAVK
LAVEAIADTDNDKLIRYMMDDVLAVSELYQEAFAGTEYAVDEAEEVSEDAAELNPAEAQG
MALSILPSEAEGPSRAVLVIGEAEEEDGPAATPSNAEILDEEDADIADEDEWILSEDEEA
TPSNADFVENRKATASNADTEEDAPAAKATDSNAEEPDKKPVVPEKLGGVKVDAEHCYSF
GTQLFLEKEDGERSRLSMKAPIRLEVTLPECIDPERKIVAAVFGENGKEYPVTWKLEEDR
LVLMLSRTGTIVLANAEGENPENPETELFHVVIDPDIQNGTVTANRLEGPEGTEIILKAV
PDSRYRLGALYVNGEKVKTASDGTCRLILHEDIEVTAEFRRKRSGGSGSSGSLAGGPAVS
ASGSWQSEGGRWKYRKADGSYETNSWSLIQNTWYCFDAEGYMRTGWYFETKDQHWYYLLP
SGAMAAGWQNIDGKWYFLNDMTRGNTGWTLQESAWTVNQQQNPGMPKGALYQSGMTPDGY
QVDDQGVWVQK

Enzyme Prediction     

No EC number prediction in MGYG000001619_02587.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL8	896	1187	1.1e-80	0.9884169884169884

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd01083	GAG_Lyase	2.44e-167	498	1260	1	693	Glycosaminoglycan (GAG) polysaccharide lyase family. This family consists of a group of secreted bacterial lyase enzymes capable of acting on glycosaminoglycans, such as hyaluronan and chondroitin, in the extracellular matrix of host tissues, contributing to the invasive capacity of the pathogen. These are broad-specificity glycosaminoglycan lyases which recognize uronyl residues in polysaccharides and cleave their glycosidic bonds via a beta-elimination reaction to form a double bond between C-4 and C-5 of the non-reducing terminal uronyl residues of released products. Substrates include chondroitin, chondroitin 4-sulfate, chondroitin 6-sulfate, and hyaluronic acid. Family members include chondroitin AC lyase, chondroitin abc lyase, xanthan lyase, and hyalurate lyase.
pfam02278	Lyase_8	7.66e-89	896	1187	1	252	Polysaccharide lyase family 8, super-sandwich domain. This family consists of a group of secreted bacterial lyase enzymes EC:4.2.2.1 capable of acting on hyaluronan and chondroitin in the extracellular matrix of host tissues, contributing to the invasive capacity of the pathogen.
pfam08124	Lyase_8_N	1.15e-54	522	847	19	315	Polysaccharide lyase family 8, N terminal alpha-helical domain. This family consists of a group of secreted bacterial lyase enzymes EC:4.2.2.1 capable of acting on hyaluronan and chondroitin in the extracellular matrix of host tissues, contributing to the invasive capacity of the pathogen.
NF033840	PspC_relate_1	1.51e-20	1799	1930	506	648	PspC-related protein choline-binding protein 1. Members of this family share C-terminal homology to the choline-binding form of the pneumococcal surface antigen PspC, but not to its allelic LPXTG-anchored forms because they lack the choline-binding repeat region. Members of this family should not be confused with PspC itself, whose identity and function reflect regions N-terminal to the choline-binding region. See Iannelli, et al. (PMID: 11891047) for information about the different allelic forms of PspC.
cd01083	GAG_Lyase	1.21e-18	1	313	387	693	Glycosaminoglycan (GAG) polysaccharide lyase family. This family consists of a group of secreted bacterial lyase enzymes capable of acting on glycosaminoglycans, such as hyaluronan and chondroitin, in the extracellular matrix of host tissues, contributing to the invasive capacity of the pathogen. These are broad-specificity glycosaminoglycan lyases which recognize uronyl residues in polysaccharides and cleave their glycosidic bonds via a beta-elimination reaction to form a double bond between C-4 and C-5 of the non-reducing terminal uronyl residues of released products. Substrates include chondroitin, chondroitin 4-sulfate, chondroitin 6-sulfate, and hyaluronic acid. Family members include chondroitin AC lyase, chondroitin abc lyase, xanthan lyase, and hyalurate lyase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SET74231.1	0.0	7	1930	41	1914
ASM70662.1	0.0	377	1316	72	1010
ASM68536.1	0.0	378	1318	11	929
QPW55123.1	1.03e-138	448	1313	86	914
QPW53528.1	1.41e-138	466	1313	102	914

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6F2P_A	1.09e-99	497	1290	4	726	Structureof Paenibacillus xanthan lyase to 2.6 A resolution [Paenibacillus]
1X1H_A	3.42e-97	497	1316	2	751	ChainA, xanthan lyase [Bacillus sp. GL1],1X1I_A Chain A, xanthan lyase [Bacillus sp. GL1],1X1J_A Chain A, xanthan lyase [Bacillus sp. GL1]
1J0M_A	4.64e-97	497	1316	2	751	CrystalStructure of Bacillus sp. GL1 Xanthan Lyase that Acts on Side Chains of Xanthan [Bacillus sp. GL1],1J0N_A Crystal Structure of Bacillus sp. GL1 Xanthan Lyase that Acts on Side Chains of Xanthan [Bacillus sp. GL1]
2E24_A	6.28e-97	497	1316	2	751	ChainA, Xanthan lyase [Bacillus sp. GL1]
2E22_A	6.28e-97	497	1316	2	751	Crystalstructure of xanthan lyase in complex with mannose [Bacillus sp. GL1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9AQS0	1.60e-94	497	1316	27	776	Xanthan lyase OS=Bacillus sp. (strain GL1) OX=84635 GN=xly PE=1 SV=1
Q54873	6.44e-60	578	1222	359	954	Hyaluronate lyase OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=SP_0314 PE=1 SV=2
Q53591	7.54e-58	454	1215	214	928	Hyaluronate lyase OS=Streptococcus agalactiae serotype III (strain NEM316) OX=211110 GN=hylB PE=1 SV=2
Q59801	5.28e-54	620	1184	177	691	Hyaluronate lyase OS=Staphylococcus aureus (strain NCTC 8325 / PS 47) OX=93061 GN=hysA PE=3 SV=1
P0CZ01	4.04e-37	583	1323	113	805	Hyaluronate lyase OS=Cutibacterium acnes (strain DSM 16379 / KPA171202) OX=267747 GN=PPA0380 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000081	0.000002	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001619_02587.