CAZyme Information: MGYG000001620_00088

Basic Information

• Species: UMGS1907 sp900556165
• Lineage: Bacteria; Patescibacteria; Saccharimonadia; Saccharimonadales; Saccharimonadaceae; UMGS1907; UMGS1907 sp900556165
• CAZyme ID: MGYG000001620_00088
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
331	MGYG000001620_4|CGC1	38100.43	10.0645

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001620	606682	MAG	China	Asia

• Gene Location: Start: 430; End: 1425 Strand: +

Full Sequence      

MKNIIVILNFNGWQDTQKCLAALSKQTIQDFEIYLIDNGSKDESIKELSKIKMPNLHFHK
EKKNTGFTGGVNIGIKWAIKNGFKNIVLLNNDANAEPEWLENLLKPLEKSPEIGAVTSLM
LDKTGKFIDDAGDVYSTWGIPMLRNENELKKNAPKSGFIFGGTGGATLYRSKVFKTIGFF
DEDFFAYNEDVDIDWRMQLAGFKVWYEKSAVVWHKHSATSSKIPGFTINQVFKNLPQVFW
KNVPFPIIIPMFFKFYAIYWAFVIYQIPKGGLKFALKGVWQGILLMPDSLKKRREIQKSK
IVSNEYLESILYHGLPLKQVNRIKDFLKFKF

Enzyme Prediction     

No EC number prediction in MGYG000001620_00088.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	5	174	2.2e-21	0.9647058823529412

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1216	GT2	2.10e-58	1	307	2	301	Glycosyltransferase, GT2 family [Carbohydrate transport and metabolism].
cd04186	GT_2_like_c	4.27e-49	5	216	1	166	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
cd04185	GT_2_like_b	3.87e-23	6	216	2	174	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
pfam00535	Glycos_transf_2	6.22e-20	5	174	2	164	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.
cd00761	Glyco_tranf_GTA_type	1.84e-19	5	206	1	156	Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold. Glycosyltransferases (GTs) are enzymes that synthesize oligosaccharides, polysaccharides, and glycoconjugates by transferring the sugar moiety from an activated nucleotide-sugar donor to an acceptor molecule, which may be a growing oligosaccharide, a lipid, or a protein. Based on the stereochemistry of the donor and acceptor molecules, GTs are classified as either retaining or inverting enzymes. To date, all GT structures adopt one of two possible folds, termed GT-A fold and GT-B fold. This hierarchy includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. The majority of the proteins in this superfamily are Glycosyltransferase family 2 (GT-2) proteins. But it also includes families GT-43, GT-6, GT-8, GT13 and GT-7; which are evolutionarily related to GT-2 and share structure similarities.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QCT42575.1	3.05e-181	1	330	14	343
AJA06666.1	2.90e-76	5	329	6	333
QCT41847.1	2.90e-76	5	329	6	333
QGU27539.1	1.31e-75	1	319	7	329
QUB37564.1	3.48e-74	1	328	1	330

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P9WMY3	2.21e-09	5	224	7	245	N-acetylglucosaminyl-diphospho-decaprenol L-rhamnosyltransferase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=wbbL PE=1 SV=2
P9WMY2	2.21e-09	5	224	7	245	N-acetylglucosaminyl-diphospho-decaprenol L-rhamnosyltransferase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=wbbL PE=3 SV=2
P75905	2.63e-09	5	213	79	279	Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Escherichia coli (strain K12) OX=83333 GN=pgaC PE=1 SV=1
Q8XAR5	2.63e-09	5	213	79	279	Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Escherichia coli O157:H7 OX=83334 GN=pgaC PE=3 SV=1
Q57287	1.89e-08	5	237	9	238	Uncharacterized glycosyltransferase HI_1578 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=HI_1578 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000063	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
243	265